Property Summary

NCBI Gene PubMed Count 24
PubMed Score 167.45
PubTator Score 88.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Immunodeficiency 23 3 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.452 1.3e-03
Astrocytoma, Pilocytic 1.400 1.1e-07
Breast cancer 2.000 3.1e-02
diabetes mellitus -1.700 1.7e-02
group 3 medulloblastoma 1.100 1.9e-03
lung cancer -1.600 9.6e-04
malignant mesothelioma -1.200 1.8e-06
non-small cell lung cancer 1.042 4.0e-15
ovarian cancer -1.300 3.1e-04
pancreatic cancer -1.500 1.5e-03
primary pancreatic ductal adenocarcinoma -1.504 2.1e-03
psoriasis -1.200 1.7e-03
tuberculosis -1.100 4.7e-06
ulcerative colitis 1.600 4.3e-07

 OMIM Phenotype (1)

Gene RIF (10)

AA Sequence

MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEED      1 - 70
NGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSV     71 - 140
IDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKV    141 - 210
DCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDAD    211 - 280
RIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTK    281 - 350
TGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI    351 - 420
SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAINDLVKKYKL    421 - 490
SRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQPGF                      491 - 542
//

Text Mined References (33)

PMID Year Title