Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
R01 Count 9
Funding $1,720,749.2
PubMed Score 22.73
PubTator Score 14.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
permanent atrial fibrillation -1.700 0.009

Gene RIF (13)

PMID Text
26631724 The Prodomain-bound Form of Bone Morphogenetic Protein 10 Is Biologically Active on Endothelial Cells.
24551273 BMP10, is elevated in the stenotic colon segment of Hirschsprung disease patients, and BMP10 signaling may play a pivotal role in disease development.
23645739 Low expression of bone morphogenetic protein-10 is associated with urothelial cancer of the bladder.
21737454 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21550985 Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608934 Bone morphogenetic protein-10 (BMP-10) may function as a tumor suppressor in breast cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSD      1 - 70
IPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEV     71 - 140
IMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRW    141 - 210
QKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLP    211 - 280
ELDNLGLDSFSSGPGEEALLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAY    281 - 350
ECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSE    351 - 420
CGCR                                                                      421 - 424
//

Text Mined References (20)

PMID Year Title
26631724 2016 The Prodomain-bound Form of Bone Morphogenetic Protein 10 Is Biologically Active on Endothelial Cells.
24551273 2014 Expression analysis of BMP2, BMP5, BMP10 in human colon tissues from Hirschsprung disease patients.
23645739 2013 Expression of bone morphogenetic protein-10 (BMP10) in human urothelial cancer of the bladder and its effects on the aggressiveness of bladder cancer cells in vitro.
21737454 2011 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21550985 2011 Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20608934 2010 Bone morphogenetic protein-10 (BMP-10) inhibits aggressiveness of breast cancer cells and correlates with poor prognosis in breast cancer.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...