Property Summary

NCBI Gene PubMed Count 29
PubMed Score 116.50
PubTator Score 38.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.8e-06
sonic hedgehog group medulloblastoma 467 1.0e-04
osteosarcoma 7950 1.3e-03
pituitary cancer 1972 4.7e-03
lung cancer 4740 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Muscular atrophy 71 3.099 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.500 1.2e-02
osteosarcoma -1.817 1.3e-03
ovarian cancer 1.100 3.8e-06
pituitary cancer 1.100 4.7e-03
sonic hedgehog group medulloblastoma -1.300 1.0e-04

Gene RIF (22)

AA Sequence

MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAAAGVGGERSSRPAPSVAPEPDGCPVCVWRQH      1 - 70
SRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDEYHATTE     71 - 140
TVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLRPVPRPATVYLQILRLKPLTGEGTAG    141 - 210
GGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEG    211 - 280
LHPFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFM    281 - 350
QKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS                 351 - 407
//

Text Mined References (29)

PMID Year Title