Property Summary

NCBI Gene PubMed Count 22
Grant Count 64
R01 Count 41
Funding $7,043,680.67
PubMed Score 91.38
PubTator Score 38.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.817 0.001
lung cancer -1.500 0.012
sonic hedgehog group medulloblastoma -1.300 0.000
ovarian cancer 1.300 0.000
pituitary cancer 1.100 0.005

Synonym

Accession O95390 Q9UID1 Q9UID2 GDF-11
Symbols BMP11
BMP-11

Gene

PANTHER Protein Class (2)

PDB

5E4G  

Gene RIF (15)

PMID Text
27034275 GDF11 is essential for mammalian development and has been suggested to regulate aging of multiple tissues. It functions in the heart, skeletal muscle, and brain. Review.
26383970 Show that there is no age-related cardiac hypertrophy in disease-free 24-month-old C57BL/6 mice and that restoring GDF11 in old mice has no effect on cardiac structure or function.
26026854 in vitro sprout formation was increased as well by GDF11 treatment
26001423 GDF11 inhibits rather than helps muscle regeneration.
25534870 GDF11 is a critical rheostat for bone turnover and a key integrator of bone homeostasis.
25352416 Suggest GDF11 functions as encephalic regionalizing factor in neural differentiated mouse embryonic stem cells.
24658077 Expression of GDF11, a cytokine which blocks terminal erythroid maturation, was increased in erthyroblasts of thalassemic patients.
24244313 These data demonstrate GDF11 to be a master regulator of neural stem cell transcription that can suppress cell proliferation and migration by regulating the expression of numerous genes involved in both these processes
20734064 Observational study of gene-disease association. (HuGE Navigator)
19751112 Myostatin or 20 ng/mL BMP-11 maintain the colony and cellular morphology of undifferentiated hESC, maintain POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and display increased SMAD2/3 phosphorylation
More...

AA Sequence

MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAAAGVGGERSSRPAPSVAPEPDGCPVCVWRQH      1 - 70
SRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDEYHATTE     71 - 140
TVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLRPVPRPATVYLQILRLKPLTGEGTAG    141 - 210
GGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEG    211 - 280
LHPFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFM    281 - 350
QKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS                 351 - 407
//

Text Mined References (22)

PMID Year Title
27034275 2016 Biochemistry and Biology of GDF11 and Myostatin: Similarities, Differences, and Questions for Future Investigation.
26383970 2015 GDF11 does not rescue aging-related pathological hypertrophy.
26026854 2015 Growth differentiation factor 11 supports migration and sprouting of endothelial progenitor cells.
26001423 2015 GDF11 Increases with Age and Inhibits Skeletal Muscle Regeneration.
25534870 2015 Growth differentiation factor 11 is a protective factor for osteoblastogenesis by targeting PPARgamma.
25352416 2014 Growth differentiation factor 11 is an encephalic regionalizing factor in neural differentiated mouse embryonic stem cells.
24658077 2014 An activin receptor IIA ligand trap corrects ineffective erythropoiesis in ?-thalassemia.
24244313 2013 Transcriptional basis for the inhibition of neural stem cell proliferation and migration by the TGF?-family member GDF11.
24019467 2013 Regulation of GDF-11 and myostatin activity by GASP-1 and GASP-2.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
More...