Property Summary

NCBI Gene PubMed Count 47
Grant Count 24
R01 Count 17
Funding $1,107,247.5
PubMed Score 105.46
PubTator Score 99.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 0.005
osteosarcoma -3.431 0.000
glioblastoma 1.100 0.021
intraductal papillary-mucinous carcinoma... 1.900 0.039
adult high grade glioma 1.100 0.000
ovarian cancer 1.900 0.000

Gene RIF (39)

PMID Text
26997449 WISP3 harbored not only frameshift mutation but also mutational intratumoral heterogeneity and loss of expression, which together might play a role in tumorigenesis of GC and CRC with MSI-H by inhibiting tumor suppressor functions of WISP3.
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26493744 WISP3 variant leads to the diagnosis of SEDT-PA.
25988854 Novel and recurrent mutations in WISP3 and an atypical phenotype have been described in Indian families with progressive pseudorheumatoid dysplasia.
25794430 Novel C223G and C252X mutations in exon 4 of the WISP3 gene are responsible for progressive pseudorheumatoid dysplasia in Chinese patients.
25738435 A novel mutation c.667T>G (p.Cys223Gly) and the c.857C>G (p.Ser286*) mutation were detected in three Chinese patients with PPD.
25553839 This study identified 3 different WISP3 mutations in 2 unrelated Chinese families with spondyloepiphyseal dysplasia tarda with progressive arthropathy.
25400723 Suggest WISP3-Wnt/beta-catenin axis may have role in regulating gastric cancer cell proliferation and metastasis.
23424195 Results are indicative of an operational WISP3-IGF1 regulatory loop whereby WISP3 preserves cartilage integrity by restricting IGF1-mediated hypertrophic changes in chondrocytes, at least partly, upon interaction with IGF1.
23226100 These results reveal a novel function of the matricellular protein CCN6 and establish a mechanistic link between CCN6 and TbetaRIII in maintaining acinar organization in the breast.
More...

AA Sequence

MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRD      1 - 70
GCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPL     71 - 140
FSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCL    141 - 210
VQATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKF    211 - 280
VFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSE    281 - 350
LKIL                                                                      351 - 354
//

Text Mined References (47)

PMID Year Title
26997449 2016 Frameshift mutation of WISP3 gene and its regional heterogeneity in gastric and colorectal cancers.
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26493744 2016 An argument for early genomic sequencing in atypical cases: a WISP3 variant leads to diagnosis of progressive pseudorheumatoid arthropathy of childhood.
25988854 2015 Novel and recurrent mutations in WISP3 and an atypical phenotype.
25794430 2015 A novel compound WISP3 mutation in a Chinese family with progressive pseudorheumatoid dysplasia.
25738435 2015 Identification of a mutation in the WISP3 gene in three unrelated families with progressive pseudorheumatoid dysplasia.
25553839 2015 Novel WISP3 mutations causing spondyloepiphyseal dysplasia tarda with progressive arthropathy in two unrelated Chinese families.
25400723 2014 Silencing of WISP3 suppresses gastric cancer cell proliferation and metastasis and inhibits Wnt/?-catenin signaling.
23424195 2013 WISP3-IGF1 interaction regulates chondrocyte hypertrophy.
23226100 2012 CCN6 knockdown disrupts acinar organization of breast cells in three-dimensional cultures through up-regulation of type III TGF-? receptor.
More...