Property Summary

NCBI Gene PubMed Count 50
PubMed Score 115.87
PubTator Score 99.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthropathy, Progressive Pseudorheumatoid, of Childhood 1 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 3.8e-04
glioblastoma 1.100 2.1e-02
intraductal papillary-mucinous carcinoma... 1.900 3.9e-02
malignant mesothelioma 1.100 5.3e-03
osteosarcoma -3.431 5.0e-11
ovarian cancer 1.900 1.9e-04

Gene RIF (42)

AA Sequence

MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRD      1 - 70
GCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPL     71 - 140
FSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCL    141 - 210
VQATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKF    211 - 280
VFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSE    281 - 350
LKIL                                                                      351 - 354
//

Text Mined References (50)

PMID Year Title