Property Summary

NCBI Gene PubMed Count 82
PubMed Score 103.49
PubTator Score 70.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.941 1.7e-02
adult high grade glioma 2.100 4.3e-05
Astrocytoma, Pilocytic 1.400 1.6e-03
atypical teratoid / rhabdoid tumor 1.300 3.3e-03
Breast cancer 3.900 2.7e-02
breast carcinoma 1.200 6.9e-05
cystic fibrosis 2.398 2.7e-05
ductal carcinoma in situ 3.000 6.2e-04
ependymoma 1.300 1.6e-03
gastric carcinoma 2.900 3.5e-02
glioblastoma 1.800 6.4e-04
interstitial cystitis 2.300 7.6e-04
invasive ductal carcinoma 3.836 7.6e-08
lung adenocarcinoma 1.600 4.7e-09
malignant mesothelioma -1.100 2.1e-03
medulloblastoma 1.300 8.8e-03
medulloblastoma, large-cell 1.200 4.2e-02
non primary Sjogren syndrome sicca -1.100 1.7e-02
non-small cell lung cancer 2.844 8.0e-18
osteosarcoma 2.687 2.2e-04
ovarian cancer 1.400 1.6e-07
pancreatic cancer 2.100 1.7e-03
pituitary cancer -2.100 7.7e-06
primary pancreatic ductal adenocarcinoma 2.743 6.7e-03
ulcerative colitis 2.900 5.2e-05
X-linked cerebral adrenoleukodystrophy 2.600 6.1e-03

Gene RIF (72)

AA Sequence

MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT      1 - 70
DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNC     71 - 140
KYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVE    141 - 210
AWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPE    211 - 280
ASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPN    281 - 350
DIFADLESYPDFSEIAN                                                         351 - 367
//

Text Mined References (83)

PMID Year Title