Property Summary

NCBI Gene PubMed Count 73
PubMed Score 90.23
PubTator Score 70.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 9.87220679489559E-37
non-small cell lung cancer 2798 7.96880111081056E-18
lung adenocarcinoma 2714 4.72204682779473E-9
invasive ductal carcinoma 2950 7.63645879485486E-8
pituitary cancer 1972 7.68934020276956E-6
sonic hedgehog group medulloblastoma 1482 1.78301708072281E-5
ovarian cancer 8492 1.85427374216797E-5
cystic fibrosis 1670 2.73150897600512E-5
adult high grade glioma 2148 4.25194094432433E-5
posterior fossa group B ependymoma 1530 5.1924163091211E-5
ulcerative colitis 2087 5.22340789989962E-5
osteosarcoma 7933 2.21479699482023E-4
ductal carcinoma in situ 1745 6.24532966834094E-4
interstitial cystitis 2299 7.56233845718535E-4
pilocytic astrocytoma 3086 0.00143946505265757
malignant mesothelioma 3163 0.00205779931192612
glioblastoma 5572 0.00310507384794085
atypical teratoid / rhabdoid tumor 4369 0.00327157337243484
X-linked cerebral adrenoleukodystrophy 115 0.00605023860300329
primary pancreatic ductal adenocarcinoma 1271 0.00670945315538338
adrenocortical carcinoma 1427 0.0165310354518219
non primary Sjogren syndrome sicca 840 0.0165484109701592
pancreatic cancer 2300 0.0171282111200851
Breast cancer 3099 0.0270162221104319
gastric carcinoma 832 0.0346435827244001
medulloblastoma, large-cell 6234 0.0418038638060812
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.447 1.7

Expression

Synonym

Accession O95388 A8KAG6 E7EMM5 Q5JBS6 Q5JBS7 Q5JBS8 Q9HCS3 WISP-1
Symbols CCN4
WISP1c
WISP1i
WISP1tc

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (63)

PMID Text
26823919 WISP1 plays an important role in regulating proliferation and apoptosis of Jurkat cells.
26555637 CCN4 has a positive influence on chondrogenic differentiation by modulating the effects of TGF-beta3.
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26391330 Study showed that DNA methylation of the WISP1 promoter in the majority of the oral squamous cell carcinoma explains its expression regulation.
25794425 Its role in tumor progression and clinical outcome makes WISP1 an emerging candidate for the detection and treatment of tumors. [review]
25749038 WISP1 contributed to radioresistance primarily by repressing irradiation-induced DNA damage and activating PI3K kinase.
25732125 WISP1 functions as an oncogene for human breast cancer. Ectopic expression of WISP1 in breast cancer cells promotes cell growth and metastasis.
25405734 WISP1 polymorphisms (rs2929965, rs2929969, rs2929970, rs2929973 and rs754958) were related to the overall platinum-based chemotherapy toxicity of lung cancer in subgroup analyses.
25281430 The data suggest that WISP1 may play a role in linking obesity to inflammation and insulin resistance and could be a novel therapeutic target for obesity.
25277191 This study suggests that osteoblast-derived WISP-1 promotes migration and VCAM-1 expression in human prostate cancer cells by down-regulating miR-126 expression
More...

AA Sequence

MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT      1 - 70
DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNC     71 - 140
KYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVE    141 - 210
AWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPE    211 - 280
ASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPN    281 - 350
DIFADLESYPDFSEIAN                                                         351 - 367
//

Text Mined References (74)

PMID Year Title
26823919 2015 Knockdown of WISP1 inhibit proliferation and induce apoptosis in ALL Jurkat cells.
26555637 2016 CCN4/WISP-1 positively regulates chondrogenesis by controlling TGF-?3 function.
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26391330 2016 Identification and validation of WISP1 as an epigenetic regulator of metastasis in oral squamous cell carcinoma.
25794425 2015 CCN4/WISP1 (WNT1 inducible signaling pathway protein 1): a focus on its role in cancer.
25749038 2015 Targeting WISP1 to sensitize esophageal squamous cell carcinoma to irradiation.
25732125 2015 WNT-1 inducible signaling pathway protein-1 enhances growth and tumorigenesis in human breast cancer.
25405734 2014 WISP1 polymorphisms contribute to platinum-based chemotherapy toxicity in lung cancer patients.
25281430 2015 WISP1 is a novel adipokine linked to inflammation in obesity.
25277191 2014 Osteoblast-derived WNT-induced secreted protein 1 increases VCAM-1 expression and enhances prostate cancer metastasis by down-regulating miR-126.
More...