Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
R01 Count 2
Funding $176,531.25
PubMed Score 12.90
PubTator Score 12.53

Knowledge Summary

Patent (2,091)

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 0.002
psoriasis 2.900 0.000
tuberculosis 1.100 0.000
lung cancer -1.100 0.001
lung carcinoma -1.400 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.100 0.000

Synonym

Accession O95382 A2ACE8 A2VDG4 A2VDG5 Q59HF4 Q5SSD4 Q75PK3 Q96B75
Symbols ASK2
MEKK6
MAPKKK6

Gene

PANTHER Protein Class (3)

 Grant Application (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (7)

PMID Text
26243192 Data show that the MAPKKK6 ASK2, a modulator of MAPKKK5 ASK1 signaling, was essential for ASK1-dependent apoptosis, but not for inducing interferon-beta (IFNB) expression.
25340522 MAP3K6 acts as a tumor suppressor, and studies showing the presence of somatic mutations in MAP3K6 in non-hereditary gastric cancers and gastric cancer cell lines, point towards MAP3K6 variants as a predisposing factor for familial gastric cancer
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19246638 regulation of VEGF by MAP3K6 may play a crucial role in both angiogenesis and tumorigenesis.
18327563 Observational study of gene-disease association. (HuGE Navigator)
17210579 Apoptosis signal-regulating kinase (ASK) 2 functions as a mitogen-activated protein kinase kinase kinase in a heteromeric complex with ASK1.

AA Sequence

MAGPCPRSGAERAGSCWQDPLAVALSRGRQLAAPPGRGCARSRPLSVVYVLTREPQPGLEPREGTEAEPL      1 - 70
PLRCLREACAQVPRPRPPPQLRSLPFGTLELGDTAALDAFYNADVVVLEVSSSLVQPSLFYHLGVRESFS     71 - 140
MTNNVLLCSQADLPDLQALREDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGLADGLVQAGVGTE    141 - 210
ALLTPLVGRLARLLEATPTDSCGYFRETIRRDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNL    211 - 280
LLSYRDVQDYSAIIELVETLQALPTCDVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQLEGSVAP    281 - 350
DLYCMCGRIYKDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGM    351 - 420
KLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRPT    421 - 490
PEPPGGPPRRAHFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPE    491 - 560
TQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLCFPSVGHCQWFCGLIQAWVTNPDSTAPAE    561 - 630
EAEGAGEMLEFDYEYTETGERLVLGKGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRL    631 - 700
RHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHR    701 - 770
DIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVI    771 - 840
EMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTLLGDPFLQPGK    841 - 910
RSRSPSSPRHAPRPSDAPSASPTPSANSTTQSQTFPCPQAPSQHPPSPPKRCLSYGGTSQLRVPEEPAAE    911 - 980
EPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGARLGRNHVEELLRCLGAHIHTP    981 - 1050
NRRQLAQELRALQGRLRAQGLGPALLHRPLFAFPDAVKQILRKRQIRPHWMFVLDSLLSRAVRAALGVLG   1051 - 1120
PEVEKEAVSPRSEELSNEGDSQQSPGQQSPLPVEPEQGPAPLMVQLSLLRAETDRLREILAGKEREYQAL   1121 - 1190
VQRALQRLNEEARTYVLAPEPPTALSTDQGLVQWLQELNVDSGTIQMLLNHSFTLHTLLTYATRDDLIYT   1191 - 1260
RIRGGMVCRIWRAILAQRAGSTPVTSGP                                             1261 - 1288
//

Text Mined References (20)

PMID Year Title
26243192 2015 The ASK family kinases differentially mediate induction of type I interferon and apoptosis during the antiviral response.
25340522 2014 Germline mutations in MAP3K6 are associated with familial gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19935702 2010 Dual engagement of 14-3-3 proteins controls signal relay from ASK2 to the ASK1 signalosome.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19246638 2009 Mitogen-activated protein 3 kinase 6 mediates angiogenic and tumorigenic effects via vascular endothelial growth factor expression.
19214184 2009 ASK1 and ASK2 differentially regulate the counteracting roles of apoptosis and inflammation in tumorigenesis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...