Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $383,630.2
PubMed Score 38.45
PubTator Score 31.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25936980 Expression of TNFAIP8 is up-regulated in human gastric cancer and regulates cell proliferation, invasion and migration.
24767861 our findings indicate that TNFAIP8 overexpression is an independent predictor of platinum resistance in epithelial ovarian cancer
24621012 Our data suggest that TNFAIP8 overexpression may contribute to lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma.
24590269 TNFAIP8 may be used as a prognostic marker for the recurrence of endometrial cancer (EC), and its promotion of the proliferation and metastasis in EC may be due to its mediation of Ki-67 and MMP9.
24464924 SCC-S2 may play roles in affecting both immune cells and tumor cells in the thyroid and may indicate a novel pathway for understanding the pathogenesis of the disease.
24162774 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8) in human B cells
24136748 These results provide evidence that TNFAIP8 plays critical roles in non-small cell lung cancer
23299407 the TNFAIP8-rs11064 Single nucleotide polymorphism may function by affecting the affinity of miR-22 binding to the 3'-untranslated region of TNFAIP8 and regulating TNFAIP8 expression, thus contributing to cervical cancer risk
23280553 TNFAIP8 functions in oncogenesis are likely to involve activation of the integrin, MMP and VEGFR-2 signaling pathways. TNFAIP8 expression revealed correlation of both cytoplasmic and nuclear TNFAIP8 overexpression with high grade prostatic adenocarcinomas
22886548 SCC-S2 is overexpressed in colon cancers.
More...

AA Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK      1 - 70
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH     71 - 140
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI                141 - 198
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936980 2015 Expression of tumor necrosis factor ?-induced protein 8 is upregulated in human gastric cancer and regulates cell proliferation, invasion and migration.
25416956 2014 A proteome-scale map of the human interactome network.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24767861 2014 TNFAIP8 overexpression is associated with platinum resistance in epithelial ovarian cancers with optimal cytoreduction.
24621012 2014 TNFAIP8 overexpression is associated with lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma.
24590269 2014 Correlation of TNFAIP8 overexpression with the proliferation, metastasis, and disease-free survival in endometrial cancer.
24464924 2014 Upregulation of SCC-S2 in immune cells and tumor tissues of papillary thyroid carcinoma.
24136748 2014 Variance of TNFAIP8 expression between tumor tissues and tumor-infiltrating CD4+ and CD8+ T cells in non-small cell lung cancer.
23299407 2013 Functional variants in TNFAIP8 associated with cervical cancer susceptibility and clinical outcomes.
More...