Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.19
PubTator Score 10.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Skin Neoplasms 69 0.0 0.0
Disease Target Count Z-score Confidence
Erythrokeratodermia variabilis 10 4.573 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.100 1.2e-03
esophageal adenocarcinoma -2.000 2.0e-02
interstitial cystitis -1.700 1.5e-03
malignant mesothelioma -3.500 1.2e-08
non-small cell lung cancer 1.980 4.4e-13

Gene RIF (3)

AA Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGCSNVCFDEFFP      1 - 70
VSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNPGKKRGGLWWTYVCSLVFKAS     71 - 140
VDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKPSEKNIFTLFMVATAAICILLNLVELIYLVS    141 - 210
KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL           211 - 273
//

Text Mined References (13)

PMID Year Title