Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.18
PubTator Score 10.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Skin Neoplasms 49
Disease Target Count P-value
non-small cell lung cancer 2798 4.37412028237838E-13
malignant mesothelioma 3163 1.1629874653435E-8
interstitial cystitis 2299 1.20788665571715E-5
diabetes mellitus 1663 0.00119846809439444
esophageal adenocarcinoma 737 0.0199506266302449
Disease Target Count Z-score Confidence
Erythrokeratodermia variabilis 10 4.561 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
esophageal adenocarcinoma -2.000 0.020
non-small cell lung cancer 1.980 0.000
diabetes mellitus 1.100 0.001
interstitial cystitis -2.000 0.000

Synonym

Accession O95377 Q9UPA3
Symbols CX31.1

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
25388970 autophagy contributed to Cx31.1 degradation, and clathrin might be involved in the autophagy of Cx31.1.
21777377 Overexpression of Cx31.1 in H1299 cells reduced cell proliferation, delayed the G1 phase, inhibited anchorage-independent growth, and suppressed cell migration and invasion. Xenografts of Cx31.1 overexpressing H1299 cells had reduced tumourigenicity.
19339270 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGCSNVCFDEFFP      1 - 70
VSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNPGKKRGGLWWTYVCSLVFKAS     71 - 140
VDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKPSEKNIFTLFMVATAAICILLNLVELIYLVS    141 - 210
KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL           211 - 273
//

Text Mined References (13)

PMID Year Title
25388970 2015 Connexin 31.1 degradation requires the Clathrin-mediated autophagy in NSCLC cell H1299.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21777377 2012 Cx31.1 acts as a tumour suppressor in non-small cell lung cancer (NSCLC) cell lines through inhibition of cell proliferation and metastasis.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19283857 2009 Connexin mutations in Brazilian patients with skin disorders with or without hearing loss.
18763093 2001 Cloning, mapping and mutation analysis of human geneGJB5 encoding gap junction protein beta-5.
17302988 2007 Novel gene expression patterns along the proximo-distal axis of the mouse embryo before gastrulation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...