Property Summary

NCBI Gene PubMed Count 25
PubMed Score 28.38
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Oculopharyngeal muscular dystrophy 3 3.044 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
lung cancer 1.200 6.5e-04
osteosarcoma -1.196 1.8e-06
ovarian cancer -1.400 5.3e-06
Pick disease -1.300 2.8e-07

Gene RIF (10)

AA Sequence

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESE      1 - 70
GALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCA     71 - 140
VCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKY    141 - 210
RRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKC    211 - 280
ADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIV    281 - 350
NQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC    351 - 420
RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDF    421 - 490
HDT                                                                       491 - 493
//

Text Mined References (28)

PMID Year Title