Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
R01 Count 1
Funding $35,341.9
PubMed Score 26.36
PubTator Score 20.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.483 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.019
lung cancer 1.200 0.001
group 3 medulloblastoma 1.100 0.002
Pick disease -1.300 0.000
ovarian cancer -1.400 0.000

Synonym

Accession O95376 Q9HBZ6 Q9UEM9 ARI-2
Symbols ARI2
TRIAD1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (9)

PMID Text
24486325 We show that ARIH2 E3-ligase regulates PABPN1 protein accumulation and aggregation
24076655 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
22940738 study demonstrated that TRIAD1 is a ubiquitination target for proteasome-dependent degradation by MDM2; results suggest TRIAD1 degradation by MDM2 suppresses TRIAD1-mediated cell growth; data suggested a novel negative regulatory mechanism of TRIAD1 via MDM2 E3 ligase ubiquitination
22819825 TRIAD1 as a novel modulator of the p53-MDM2 axis that induces p53 activation by inhibiting its regulation by MDM2.
22037423 In sharp contrast to SIAH1/SIAH2 and UBCH8, TRIAD1 binding to PML-RARalpha has no effect on its turnover.
21454682 HoxA10 influences protein ubiquitination by activating transcription of ARIH2, the gene encoding Triad1
19340006 Triad1 has dual ubiquitin ligase activity; both its RING domains are crucial for inhibiting myeloid proliferation. The N-terminal RING finger (RING1) of Triad1 binds UbcH7; the C-terminal RING finger (RING2) binds Ubc13.
17646546 The fine-tuning of Gfi1 protein levels regulated by Triad1 defines an unexpected role for this protein in hematopoiesis.
16118314 proteasomal degradation of proteins that are ubiquitinated by Triad1 affects the clonogenic growth of primary myeloid progenitor cells

AA Sequence

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESE      1 - 70
GALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCA     71 - 140
VCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKY    141 - 210
RRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKC    211 - 280
ADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIV    281 - 350
NQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC    351 - 420
RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDF    421 - 490
HDT                                                                       491 - 493
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24486325 2014 A novel feed-forward loop between ARIH2 E3-ligase and PABPN1 regulates aging-associated muscle degeneration.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24076655 2013 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
24058416 2013 Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940738 2012 TRIAD1 is negatively regulated by the MDM2 E3 ligase.
22819825 2012 TRIAD1 inhibits MDM2-mediated p53 ubiquitination and degradation.
22037423 2012 Differential regulation of PML-RAR? stability by the ubiquitin ligases SIAH1/SIAH2 and TRIAD1.
21454682 2011 HoxA10 influences protein ubiquitination by activating transcription of ARIH2, the gene encoding Triad1.
More...