Property Summary

NCBI Gene PubMed Count 35
PubMed Score 46.85
PubTator Score 33.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 5.2e-08
medulloblastoma, large-cell 6241 2.6e-05
psoriasis 6694 3.7e-05
osteosarcoma 7950 4.3e-04
lung cancer 4740 5.1e-04
ovarian cancer 8520 1.1e-03
Multiple myeloma 1332 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
triple-A syndrome 17 3.035 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
lung adenocarcinoma 1.183 5.2e-08
lung cancer 1.500 5.1e-04
medulloblastoma, large-cell 1.400 2.6e-05
Multiple myeloma 1.208 1.7e-02
osteosarcoma 1.244 4.3e-04
ovarian cancer -1.200 1.1e-03
psoriasis -2.200 3.7e-05

Gene RIF (27)

AA Sequence

MDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQITMSEQLDLPVRQAGVIYLKNMITQYWPD      1 - 70
RETAPGDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKHDYPSRWTAIVDKIGFYLQSD     71 - 140
NSACWLGILLCLYQLVKNYEYKKPEERSPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYAL    141 - 210
VQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGN    211 - 280
VSKEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGII    281 - 350
QDVIFPLMCYTDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILT    351 - 420
EPNADPRKKDGALHMIGSLAEILLKKKIYKDQMEYMLQNHVFPLFSSELGYMRARACWVLHYFCEVKFKS    421 - 490
DQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIRPVMQALLHIIRETENDDLTN    491 - 560
VIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAMGILNTIDTLLSVVEDHKEITQ    561 - 630
QLEGICLQVIGTVLQQHVLEFYEEIFSLAHSLTCQQVSPQMWQLLPLVFEVFQQDGFDYFTDMMPLLHNY    631 - 700
VTVDTDTLLSDTKYLEMIYSMCKKVLTGVAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVEAALERLT    701 - 770
REVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLG    771 - 840
LCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDE    841 - 910
DGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQAL    911 - 980
THGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN                981 - 1038
//

Text Mined References (45)

PMID Year Title