Property Summary

NCBI Gene PubMed Count 32
Grant Count 6
R01 Count 4
Funding $667,660.2
PubMed Score 43.37
PubTator Score 33.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.615 0.003
psoriasis -2.200 0.000
osteosarcoma 1.852 0.000
medulloblastoma, large-cell 1.500 0.000
lung cancer 1.500 0.001
lung adenocarcinoma 1.183 0.000
ovarian cancer 2.100 0.000

Gene RIF (42)

PMID Text
26085085 Depletion of IPO7 by IPO7 siRNA reduced nuclear accumulation of GLI1. In addition, FOXM1 induced nuclear import of GLI1 by promoting IPO7 expression.
24586428 Importin 7 as a soluble nuclear transport factor that is required for efficient import of the protein component of human telomerase.
24100013 Importin 7 contributes to the regulation of androgen receptor import by restraining import until androgen is detected in the cytoplasm.
23439083 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23439083 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23439083 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23439083 High levels of additive and synergic antiretroviral activity are obtained by using antiretroviral compounds (T1249, 3TC, RAL, or IDV) in PM1 cells stably expressing anti-host shRNAs (IPO7, HSPD1, or ATG16) or anti-HIV shRNAs (Pol, RT, or Nef)
23125841 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQITMSEQLDLPVRQAGVIYLKNMITQYWPD      1 - 70
RETAPGDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKHDYPSRWTAIVDKIGFYLQSD     71 - 140
NSACWLGILLCLYQLVKNYEYKKPEERSPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYAL    141 - 210
VQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGN    211 - 280
VSKEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGII    281 - 350
QDVIFPLMCYTDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILT    351 - 420
EPNADPRKKDGALHMIGSLAEILLKKKIYKDQMEYMLQNHVFPLFSSELGYMRARACWVLHYFCEVKFKS    421 - 490
DQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIRPVMQALLHIIRETENDDLTN    491 - 560
VIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAMGILNTIDTLLSVVEDHKEITQ    561 - 630
QLEGICLQVIGTVLQQHVLEFYEEIFSLAHSLTCQQVSPQMWQLLPLVFEVFQQDGFDYFTDMMPLLHNY    631 - 700
VTVDTDTLLSDTKYLEMIYSMCKKVLTGVAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVEAALERLT    701 - 770
REVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLG    771 - 840
LCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDE    841 - 910
DGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQAL    911 - 980
THGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN                981 - 1038
//

Text Mined References (42)

PMID Year Title
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26085085 2015 Forkhead Box M1 Is Essential for Nuclear Localization of Glioma-associated Oncogene Homolog 1 in Glioblastoma Multiforme Cells by Promoting Importin-7 Expression.
24586428 2014 Importin 7 and Nup358 promote nuclear import of the protein component of human telomerase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100013 2013 Androgen induces a switch from cytoplasmic retention to nuclear import of the androgen receptor.
23067392 2013 Importin-7 mediates nuclear trafficking of DNA in mammalian cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22284678 2012 Importin 7 and exportin 1 link c-Myc and p53 to regulation of ribosomal biogenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21419860 2011 Nuclear import of early growth response-1 involves importin-7 and the novel nuclear localization signal serine-proline-serine.
More...