Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
R01 Count 1
Funding $292,128
PubMed Score 9.95
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95372 Q7Z4Z2 APT-2
Symbols APT2
APT-2
DJ886K2.4

Gene

PANTHER Protein Class (3)

 Grant Application (2)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651986 other 2 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1 and LYPLA2: Fluorescence-based biochemical gel-based ABPP evaluation of activity in situ
652001 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: Substrate-based fluorescence-based biochemical determination of kinetic parameters
652004 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: fluorescence-based biochemical dose-response assay
652029 other 39 / 0 / 115 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: Fluorescence-based biochemical gel-based ABPP inhibition
652030 other 7 / 0 / 42 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (4)

PMID Text
25849916 Here, we describe the conserved functions of APT1 and APT2 across organisms and discuss the possibility that these enzymes are members of a larger family of depalmitoylation enzymes.
25301951 LYPLA2 is the major prostaglandin glycerol ester hydrolase in human cancer cells.
23396970 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43
21152083 Results demonstrate that APT-2 is the protein thioesterase involved in the acylation/deacylation cycle operating in GAP-43 subcellular distribution.

AA Sequence

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM      1 - 70
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA     71 - 140
GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH    141 - 210
SSCPQEMAAVKEFLEKLLPPV                                                     211 - 231
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849916 2015 Enzymatic protein depalmitoylation by acyl protein thioesterases.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25301951 2014 Identification of the major prostaglandin glycerol ester hydrolase in human cancer cells.
23396970 2013 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43.
21269460 2011 Initial characterization of the human central proteome.
21152083 2010 Acyl-protein thioesterase 2 catalyzes the deacylation of peripheral membrane-associated GAP-43.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...