Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (362)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.8e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.176 1.8e-06

AA Sequence

MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMYFFLSNLSSLD      1 - 70
LAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAFDRYVAVCRPLRYTAIMNPQL     71 - 140
CWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCEVPAMIKLACGDTSLNQAVLNGVCTFFTAVP    141 - 210
LSIIVISYCLIAQAVLKIRSAEGRRKAFNTCLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSL    211 - 280
VTPMVNPLIYTLRNMEVKGALRRLLGKGREVG                                          281 - 312
//

Text Mined References (5)

PMID Year Title