Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (362)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.83318528374452E-6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.176 0.000

Synonym

Accession O95371 A0AVA4 Q6IF34 Q6IF55
Symbols OLFmf3
OR2C2P

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum EggNOG Inparanoid

AA Sequence

MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMYFFLSNLSSLD      1 - 70
LAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAFDRYVAVCRPLRYTAIMNPQL     71 - 140
CWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCEVPAMIKLACGDTSLNQAVLNGVCTFFTAVP    141 - 210
LSIIVISYCLIAQAVLKIRSAEGRRKAFNTCLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSL    211 - 280
VTPMVNPLIYTLRNMEVKGALRRLLGKGREVG                                          281 - 312
//

Text Mined References (5)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847080 1998 Construction of an approximately 700-kb transcript map around the familial Mediterranean fever locus on human chromosome 16p13.3.