Property Summary

NCBI Gene PubMed Count 63
Grant Count 29
R01 Count 18
Funding $2,399,259.56
PubMed Score 115.57
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (58)

PMID Text
26816381 this study found that LRF/ZBTB7A transcription factor occupies fetal gamma-globin genes and maintains the nucleosome density necessary for gamma-globin gene silencing in adults, and that LRF confers its repressive activity through a NuRD repressor complex independent of the fetal globin repressor BCL11A.
26164003 MEF2D was also found to increase the transcription of Pokemon by binding myocyte enhancer factor 2 (MEF2) sites within its promoter region, that can promote Hepatocellular carcinoma invasion
25995384 ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM
25722217 our findings suggest that TGF-b1 may inhibit the expression of Pokemon, b-catenin, and E-cadherin. The high expression of TGF-b1 leads to an increase in the phenotype and apical-base polarity of epithelial cells
25514493 Taken together, all these data suggest that Pokemon is a new partner of Smad4 and plays a negative role in TGF-beta pathway.
25367850 Pokemon enhanced the oncogenesis of colorectal cancer by promoting cell proliferation, cell cycle progression and anti-apoptosis activity.
25184678 ZBTB7A, a member of the POK (POZ/BTB and Kruppel) transcription repressor family, directly binds to the promoter and represses the transcription of critical glycolytic genes, including GLUT3, PFKP, and PKM
24857950 a potential regulatory role of FBI-1 in transcription factor activity of ETS-1
24514149 An unexpected function for FBI-1 in splicing modulation with a direct impact on cell survival.
24393848 Investigated the functions of Pokemon in the carcinogenesis and development of bladder cancer and observed the inhibitory effects of siRNA expression vector on Pokemon in bladder cancer cells.
More...

AA Sequence

MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVD      1 - 70
QQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADA     71 - 140
GQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVA    141 - 210
AGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEA    211 - 280
ASLSEAAPEPGDSPGFLSGAAEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMD    281 - 350
YYLKYFSGAHDGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT    351 - 420
RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGC    421 - 490
NGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAG    491 - 560
AGGGGDSGGGPGAATDGNFTAGLA                                                  561 - 584
//

Text Mined References (74)

PMID Year Title
26816381 2016 Transcription factors LRF and BCL11A independently repress expression of fetal hemoglobin.
26164003 2015 Pokemon and MEF2D co-operationally promote invasion of hepatocellular carcinoma.
25995384 2015 ZBTB7A Suppresses Melanoma Metastasis by Transcriptionally Repressing MCAM.
25722217 2015 Evaluation of transforming growth factor-?1 suppress Pokemon/epithelial-mesenchymal transition expression in human bladder cancer cells.
25514493 2015 Pokemon (FBI-1) interacts with Smad4 to repress TGF-?-induced transcriptional responses.
25416956 2014 A proteome-scale map of the human interactome network.
25367850 2014 Pokemon enhances proliferation, cell cycle progression and anti-apoptosis activity of colorectal cancer independently of p14ARF-MDM2-p53 pathway.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25184678 2014 ZBTB7A acts as a tumor suppressor through the transcriptional repression of glycolysis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...