Property Summary

Ligand Count 2
NCBI Gene PubMed Count 28
PubMed Score 111.90
PubTator Score 12.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
tuberculosis 2010 3.7e-10
osteosarcoma 7950 3.5e-06
posterior fossa group B ependymoma 416 7.3e-06
group 3 medulloblastoma 4104 1.8e-03
psoriasis 6694 1.9e-03
ovarian cancer 8520 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.8
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.8e-03
osteosarcoma -1.314 3.5e-06
ovarian cancer 1.300 2.4e-03
posterior fossa group B ependymoma 1.100 7.3e-06
psoriasis 1.600 1.9e-03
tuberculosis 3.100 3.7e-10

Gene RIF (14)

AA Sequence

MVGSALRRGAHAYVYLVSKASHISRGHQHQAWGSRPPAAECATQRAPGSVVELLGKSYPQDDHSNLTRKV      1 - 70
LTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKK     71 - 140
GDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIK    141 - 210
DGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEIN    211 - 280
FHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQ    281 - 350
KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRH    351 - 420
MERTLSQREVRHIHQALQEAAVQLLGVEGRF                                           421 - 451
//

Text Mined References (30)

PMID Year Title