Property Summary

NCBI Gene PubMed Count 23
PubMed Score 19.08
PubTator Score 15.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession O95361 Q6IAL8 Q7Z6I2 Q96BE8 Q96J43
Symbols EBBP

Gene

Gene RIF (13)

PMID Text
26902425 Data suggest that TRIM16 and TDP43 are both good prognosis indicators; data shows that TRIM16 inhibits cancer cell viability by a novel mechanism involving interaction and stabilisation of TDP43 with consequent effects on E2F1 and pRb proteins.
26718507 TRIM16 directly regulated the degradation of Gli1 protein via the ubiquitinproteasome pathway. TRIM16 expression was low in breast cancer. It negatively correlated with metastasis and suppressed stem-cell properties in breast cancer cells.
25866896 Expression of SDMGC and TRIM16 was upregulated in the distant metastasis tissues
25843803 results suggest that TRIM16 is a potential pharmacologic target for the treatment of NSCLC and promotion TRIM16 expression might represent a novel strategy to NSCLC metastasis
25333256 Chromatin immunoprecipitation assays revealed TRIM16 directly bound the IFNbeta1 gene promoter. Low level TRIM16 expression in 91 melanoma patient samples, strongly correlated with lymph node metastasis, and, predicted poor patient prognosis.
23422002 data suggest that TRIM16 acts as a novel regulator of both neuroblastoma G 1/S progression and cell differentiation
23404198 TRIM16 can promote apoptosis by directly modulating caspase-2 activity in cancer cells.
22629402 via its unique structure, TRIM16 possesses both heterodimerization function with other TRIM proteins and also has E3 ubiquitin ligase activity.
20729920 TRIM16 acts as a tumour suppressor, affecting neuritic differentiation, cell migration and replication through interactions with cytoplasmic vimentin and nuclear E2F1 in neuroblastoma cells.
19147277 The estrogen-responsive B box protein (EBBP) restores retinoid sensitivity in retinoid-resistant cancer cells via effects on histone acetylation.
More...

AA Sequence

MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAG      1 - 70
EGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSA     71 - 140
FCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSE    141 - 210
VKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQ    211 - 280
FLEEYCKFKNTEDITFPSVYVGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAV    281 - 350
VQRKYWTSKPEPSTREQFLQYAYDITFDPDTAHKYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLS    351 - 420
QQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAG    421 - 490
PFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLV    491 - 560
GTAP                                                                      561 - 564
//

Text Mined References (23)

PMID Year Title
26902425 2016 High TDP43 expression is required for TRIM16-induced inhibition of cancer cell growth and correlated with good prognosis of neuroblastoma and breast cancer patients.
26718507 2016 Tripartite motif 16 suppresses breast cancer stem cell properties through regulation of Gli-1 degradation via the ubiquitin-proteasome pathway.
25866896 2015 Long noncoding ribonucleic acid specific for distant metastasis of gastric cancer is associated with TRIM16 expression and facilitates tumor cell invasion in vitro.
25843803 2015 Tripartite motif 16 inhibits epithelial-mesenchymal transition and metastasis by down-regulating sonic hedgehog pathway in non-small cell lung cancer cells.
25333256 2014 TRIM16 inhibits proliferation and migration through regulation of interferon beta 1 in melanoma cells.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
23422002 2013 TRIM16 inhibits neuroblastoma cell proliferation through cell cycle regulation and dynamic nuclear localization.
23404198 2013 TRIM16 overexpression induces apoptosis through activation of caspase-2 in cancer cells.
22629402 2012 TRIM16 acts as an E3 ubiquitin ligase and can heterodimerize with other TRIM family members.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
More...