Property Summary

NCBI Gene PubMed Count 50
Grant Count 109
R01 Count 51
Funding $9,970,916.39
PubMed Score 364.03
PubTator Score 159.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.097 0.001

Synonym

Accession O95352 B4E170 E9PB95 Q7L8L0 Q9BWP2 Q9UFH4
Symbols GSA7
APG7L
APG7-LIKE

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26785669 We have identified ATG7 as a potential tissue biomarker distinguishing active EoE from normal, EoE remission, and GERD.
26468292 These observations indicate that Atg7-mediated autophagy is dispensable for retinoid recycling and A2E deposition; however, autophagy plays a role in coping with stress caused by A2E accumulation.
26214133 Inhibition of Atg7-mediated autophagy within the epithelium may prevent the development and progression of colorectal cancer in genetically predisposed patients.
26043688 The region of human ATG3 that interacts with ATG7 is precisely identified using nuclear magnetic resonance.
25339774 The siRNA-mediated reduction of ATG7 protein reverses Torin-1-induced HIV-1 Tat degradation, suggesting ATG7 is involved in the lysosomal-mediated Tat degradation
24362031 the Atg7.caspase-9 complex performs a dual function of linking caspase-9 to the autophagic process while keeping in check its apoptotic activity.
24023838 a protective mechanism for Atg4B, Atg3 and LC3-Atg3 conjugate from being inappropriately sequestered into p62 aggregates
23894380 the polymorphism is associated with a 6-years earlier disease onset
23640897 Data indicate mitogen lacritin stimulates FOXO3-ATG101 and FOXO1-ATG7 autophagic coupling and restores metabolic homeostasis.
23527187 2-methoxyestradiol-dependent autophagosome formation in osteosarcoma cells requires ATG7 expression.
More...

AA Sequence

MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAF      1 - 70
DMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLK     71 - 140
KYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLV    141 - 210
SLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVA    211 - 280
HSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDL    281 - 350
DKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR    351 - 420
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAAS    421 - 490
KRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPG    491 - 560
DSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFL    561 - 630
SRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDD    631 - 700
ETI                                                                       701 - 703
//

Text Mined References (59)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
26785669 2016 ATG7 Gene Expression as a Novel Tissue Biomarker in Eosinophilic Esophagitis.
26468292 2015 Di-retinoid-pyridinium-ethanolamine (A2E) Accumulation and the Maintenance of the Visual Cycle Are Independent of Atg7-mediated Autophagy in the Retinal Pigmented Epithelium.
26214133 2015 Intestinal inhibition of Atg7 prevents tumour initiation through a microbiome-influenced immune response and suppresses tumour growth.
26043688 2015 Identification and characterization of the linear region of ATG3 that interacts with ATG7 in higher eukaryotes.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24681637 2014 Atg7- and Keap1-dependent autophagy protects breast cancer cell lines against mitoquinone-induced oxidative stress.
24362031 2014 A Complex between Atg7 and Caspase-9: A NOVEL MECHANISM OF CROSS-REGULATION BETWEEN AUTOPHAGY AND APOPTOSIS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...