Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.13
PubTator Score 162.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.595 1.0e-03
adult high grade glioma 1.100 2.8e-03
atypical teratoid / rhabdoid tumor 1.600 1.5e-05
Breast cancer 2.400 2.7e-02
glioblastoma 1.600 3.3e-07
group 3 medulloblastoma 1.500 9.7e-04
head and neck cancer -1.300 4.9e-03
intraductal papillary-mucinous carcinoma... 2.000 5.4e-03
intraductal papillary-mucinous neoplasm ... 2.500 3.9e-03
invasive ductal carcinoma 1.500 1.6e-03
lung cancer 1.500 1.7e-03
medulloblastoma, large-cell 2.200 7.5e-06
nasopharyngeal carcinoma 1.200 1.2e-03
non-small cell lung cancer 1.721 5.0e-17
osteosarcoma -1.335 3.9e-02
ovarian cancer 1.100 1.3e-02
Pick disease -1.100 3.4e-04
posterior fossa group A ependymoma 1.400 1.5e-06
primitive neuroectodermal tumor 1.700 5.7e-05
progressive supranuclear palsy -1.300 3.0e-03
psoriasis 1.100 1.7e-05

Gene RIF (8)

AA Sequence

MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNG      1 - 70
QAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNN     71 - 140
PHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKL    141 - 210
KEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHE    211 - 280
IEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEK    281 - 350
EVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ    351 - 420
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIG    421 - 490
RLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTG    491 - 560
KKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC    561 - 630
DNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEE    631 - 700
ELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAE    701 - 770
EKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL    771 - 840
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNNDSQLKI    841 - 910
KELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLG    911 - 980
RNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLP    981 - 1050
GANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALD   1051 - 1120
LSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPP   1121 - 1190
KGAHVEV                                                                  1191 - 1197
//

Text Mined References (32)

PMID Year Title