Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.13
PubTator Score 162.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
non-small cell lung cancer 2798 4.97753896592668E-17
medulloblastoma 1524 3.31023527949182E-7
posterior fossa group A ependymoma 1511 1.4554411547678E-6
medulloblastoma, large-cell 6234 7.51944512247793E-6
atypical teratoid / rhabdoid tumor 4369 1.45035476859294E-5
primitive neuroectodermal tumor 3031 5.6753321635526E-5
pediatric high grade glioma 2712 9.06506178873958E-5
lung cancer 4473 1.07763857530242E-4
Pick disease 1893 3.39536333228386E-4
glioblastoma 5572 7.38222619439233E-4
adrenocortical carcinoma 1427 0.0010252080687767
nasopharyngeal carcinoma 1056 0.00117480797689992
invasive ductal carcinoma 2950 0.00158196009028844
psoriasis 6685 0.00176481773638141
progressive supranuclear palsy 674 0.00300849387321605
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00391753394583799
head and neck cancer 270 0.00489357823935912
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00539498436614679
ovarian cancer 8492 0.0129631813503457
Breast cancer 3099 0.0270162221104319
osteosarcoma 7933 0.0386089171074026
Disease Target Count Z-score Confidence
Pleural empyema 10 3.981 2.0

Expression

Synonym

Accession O95347 Q6IEE0 Q9P1P2 SMC protein 2
Symbols CAPE
CAP-E
SMC-2
SMC2L1

Gene

PDB

4U4P  

  Ortholog (13)

Gene RIF (8)

PMID Text
26491021 analysis of functional differences of SMC2 and SMC4 hinge domain between condensins and cohesin in DNA recognition
24553121 SMC2 (or the condensin complex) is a novel molecular target for the treatment of MYCN-amplified neuroblastoma.
24483990 SMC2 gene is altered by both frameshift mutation and loss of expression in gastric and colorectal cancers, suggesting that SMC2 gene alterations might be involved in pathogenesis of these cancers
23095742 WNT signaling can directly activate SMC2 transcription as a key player in the mitotic cell division machinery.
21194474 Studies indicate that tagged SMC2 subunit of the condensin complex with the streptavidin-Binding Peptide optimising efficacious use of this tag for protein analysis.
20823528 human SMC2 hinge domain with short coiled coils was cloned, expressed, purified and crystallized in the orthorhombic space group C222 in native and SeMet-derivatized forms
19454010 Interaction of HIV-1 Tat with SMC2 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17488335 mutation analysis of hCAP-C & hCAP-E in leukemia-lymphoma cell lines including 8 pyothorax-associated lymphoma (PAL); 3 of 8 PAL cell lines have hCAP-C or hCAP-E heterozygous mutations, indicating condensin mutations are relatively frequent in PAL

AA Sequence

MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNG      1 - 70
QAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNN     71 - 140
PHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKL    141 - 210
KEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHE    211 - 280
IEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEK    281 - 350
EVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ    351 - 420
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIG    421 - 490
RLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTG    491 - 560
KKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC    561 - 630
DNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEE    631 - 700
ELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAE    701 - 770
EKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL    771 - 840
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNNDSQLKI    841 - 910
KELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLG    911 - 980
RNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLP    981 - 1050
GANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALD   1051 - 1120
LSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPP   1121 - 1190
KGAHVEV                                                                  1191 - 1197
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491021 2015 Structural Basis for Dimer Formation of Human Condensin Structural Maintenance of Chromosome Proteins and Its Implications for Single-stranded DNA Recognition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24553121 2014 Inactivation of SMC2 shows a synergistic lethal response in MYCN-amplified neuroblastoma cells.
24483990 2014 Mutational and expressional analysis of SMC2 gene in gastric and colorectal cancers with microsatellite instability.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23728299 2013 The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.
23095742 2012 Human SMC2 protein, a core subunit of human condensin complex, is a novel transcriptional target of the WNT signaling pathway and a new therapeutic target.
21618603 2011 Evidence for gene-environment interaction in a genome wide study of nonsyndromic cleft palate.
21269460 2011 Initial characterization of the human central proteome.
More...