Property Summary

NCBI Gene PubMed Count 25
Grant Count 14
R01 Count 10
Funding $492,363.18
PubMed Score 5.13
PubTator Score 162.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26491021 analysis of functional differences of SMC2 and SMC4 hinge domain between condensins and cohesin in DNA recognition
24553121 SMC2 (or the condensin complex) is a novel molecular target for the treatment of MYCN-amplified neuroblastoma.
24483990 SMC2 gene is altered by both frameshift mutation and loss of expression in gastric and colorectal cancers, suggesting that SMC2 gene alterations might be involved in pathogenesis of these cancers
23095742 WNT signaling can directly activate SMC2 transcription as a key player in the mitotic cell division machinery.
21194474 Studies indicate that tagged SMC2 subunit of the condensin complex with the streptavidin-Binding Peptide optimising efficacious use of this tag for protein analysis.
20823528 human SMC2 hinge domain with short coiled coils was cloned, expressed, purified and crystallized in the orthorhombic space group C222 in native and SeMet-derivatized forms
19454010 Interaction of HIV-1 Tat with SMC2 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17488335 mutation analysis of hCAP-C & hCAP-E in leukemia-lymphoma cell lines including 8 pyothorax-associated lymphoma (PAL); 3 of 8 PAL cell lines have hCAP-C or hCAP-E heterozygous mutations, indicating condensin mutations are relatively frequent in PAL

AA Sequence

MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNG      1 - 70
QAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNN     71 - 140
PHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKL    141 - 210
KEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHE    211 - 280
IEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEK    281 - 350
EVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ    351 - 420
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIG    421 - 490
RLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTG    491 - 560
KKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC    561 - 630
DNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEE    631 - 700
ELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAE    701 - 770
EKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL    771 - 840
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNNDSQLKI    841 - 910
KELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLG    911 - 980
RNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLP    981 - 1050
GANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALD   1051 - 1120
LSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPP   1121 - 1190
KGAHVEV                                                                  1191 - 1197
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491021 2015 Structural Basis for Dimer Formation of Human Condensin Structural Maintenance of Chromosome Proteins and Its Implications for Single-stranded DNA Recognition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24553121 2014 Inactivation of SMC2 shows a synergistic lethal response in MYCN-amplified neuroblastoma cells.
24483990 2014 Mutational and expressional analysis of SMC2 gene in gastric and colorectal cancers with microsatellite instability.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23728299 2013 The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.
23095742 2012 Human SMC2 protein, a core subunit of human condensin complex, is a novel transcriptional target of the WNT signaling pathway and a new therapeutic target.
21618603 2011 Evidence for gene-environment interaction in a genome wide study of nonsyndromic cleft palate.
21269460 2011 Initial characterization of the human central proteome.
More...