Property Summary

NCBI Gene PubMed Count 25
PubMed Score 42.55
PubTator Score 25.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spondyloepimetaphyseal Dysplasia, Pakistani Type 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.410 4.2e-02
aldosterone-producing adenoma -1.280 4.0e-02
astrocytic glioma 1.100 4.8e-02
Astrocytoma, Pilocytic 1.400 1.3e-06
Barrett's esophagus 1.400 2.6e-02
colon cancer -1.900 4.8e-04
gastric carcinoma 1.200 2.6e-02
interstitial cystitis 1.200 8.5e-05
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-03
lung adenocarcinoma -1.400 1.0e-08
lung cancer -3.400 3.2e-05
lung carcinoma -2.600 6.1e-18
malignant mesothelioma -5.300 5.8e-09
medulloblastoma, large-cell -2.000 1.1e-04
nasopharyngeal carcinoma 1.600 4.3e-03
non-small cell lung cancer -1.926 3.9e-19
osteosarcoma 2.760 7.2e-04
ovarian cancer -3.700 6.2e-14
pancreatic ductal adenocarcinoma liver m... -1.612 1.9e-02
Pick disease 1.600 1.4e-02
pituitary cancer -1.600 6.1e-05
primary Sjogren syndrome 1.300 2.7e-03
tuberculosis -2.000 1.3e-05
ulcerative colitis -1.100 2.3e-04

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHA      1 - 70
IPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAG     71 - 140
LPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELL    141 - 210
QEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQV    211 - 280
MHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTC    281 - 350
TKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHAL    351 - 420
LMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGP    421 - 490
TEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKK    491 - 560
AMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN                    561 - 614
//

Text Mined References (29)

PMID Year Title