Property Summary

NCBI Gene PubMed Count 43
PubMed Score 44.98
PubTator Score 35.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.29677954242534E-47
non-small cell lung cancer 2798 3.30585794377158E-32
ovarian cancer 8492 1.15206441456953E-14
Breast cancer 3099 1.48494674088153E-12
juvenile dermatomyositis 1189 1.90339994613935E-10
lung adenocarcinoma 2714 2.06813796785312E-9
cystic fibrosis 1670 2.03629260809101E-7
atypical teratoid / rhabdoid tumor 4369 7.01401253678857E-7
acute quadriplegic myopathy 1157 2.05904503064556E-6
Amyotrophic Lateral Sclerosis 432 2.48904945247524E-6
Duchenne muscular dystrophy 602 2.78596153964056E-6
posterior fossa group A ependymoma 1511 1.16988408333738E-5
ulcerative colitis 2087 1.45695327194504E-5
glioblastoma 5572 4.89645042723651E-5
pituitary cancer 1972 5.14895231669645E-5
psoriasis 6685 8.07375171897059E-5
medulloblastoma, large-cell 6234 8.90230939435659E-5
medulloblastoma 1524 1.09450611215718E-4
breast carcinoma 1614 1.91257754358967E-4
dermatomyositis 967 4.71500581888439E-4
pilocytic astrocytoma 3086 6.48300574155856E-4
primary Sjogren syndrome 789 6.62918888633791E-4
primitive neuroectodermal tumor 3031 6.71640134125565E-4
fibroadenoma 557 0.00112572974041642
invasive ductal carcinoma 2950 0.00193432899293951
Waldenstrons macroglobulinemia 765 0.00193913584799243
adult high grade glioma 2148 0.00195268719818476
ductal carcinoma in situ 1745 0.00256065492682583
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00325556866032806
active Crohn's disease 918 0.00427441613474941
lung cancer 4473 0.00568245144680963
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00881143115984039
diabetes mellitus 1663 0.0110584646268917
osteosarcoma 7933 0.0175330541687043
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0278345263618729
chronic kidney disease 90 0.041550083294727
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0

Expression

Synonym

Accession O95319 B7ZAN9 Q7KYU4 Q8N499 Q92950 Q96NW9 Q96RQ5 Q96RQ6 Q9UL67 CELF-2
Symbols ETR3
ETR-3
NAPOR
CELF-2
CUGBP2
BRUNOL3
CUG-BP2

Gene

PDB

2MY7   2MY8   4LJM   4LMZ   4TLQ  

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (22)

PMID Text
26443849 a widespread role for the JNK-CELF2 axis in controlling splicing during T-cell activation, including a specific role in propagating JNK signaling.
26314850 the genetic variant rs3740194 in CELF2 gene might be a valuable predictor for NPC prognosis
26165303 Data show miR95 expression level positively related to glioma grade and its downregulation affects proliferation, invasion and apoptosis by targeting CELF2. MiR95 is identified as a putative therapeutic target and CELF2 as a potential tumor suppressor.
25870297 novel mechanisms for CELF2 regulation that may broadly impact CELF2 expression across diverse cell types.
25801238 The A allele of rs2242451 in CUGBP2 might decrease Alzheimer disease risk in the Chinese Han population.
21444716 Alternative splicing of LEF1 exon 6 is regulated during pre-TCR signaling in thymic development and in response to activation of the JSL1 T-cell line and this is driven by the activity of CELF2.
21439371 results indicate the occurrence of a mis-splicing event in myotonic dystrophy type 1 that is induced neither by a loss of muscleblind-like 1 (MBNL1) function nor by a gain of CUGBP1
21379329 There was evidence of association for recently-reported late-onset Alzheimer's disease risk loci, including BIN1 and CLU and CUGBP2 with APOE.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQIN      1 - 70
VLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVS     71 - 140
KKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFA    141 - 210
DTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQL    211 - 280
QNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVG    281 - 350
LNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP    351 - 420
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIG    421 - 490
MKRLKVQLKRSKNDSKPY                                                        491 - 508
//

Text Mined References (53)

PMID Year Title
26443849 2015 Widespread JNK-dependent alternative splicing induces a positive feedback loop through CELF2-mediated regulation of MKK7 during T-cell activation.
26314850 2015 Association of CELF2 polymorphism and the prognosis of nasopharyngeal carcinoma in southern Chinese population.
26165303 2015 Downregulation of miR-95-3p inhibits proliferation, and invasion promoting apoptosis of glioma cells by targeting CELF2.
25870297 2015 Induced transcription and stability of CELF2 mRNA drives widespread alternative splicing during T-cell signaling.
25801238 2015 Genetic association of CUGBP2 and DNMBP with Alzheimer' s disease in the Chinese Han population.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21444716 2011 Signal- and development-dependent alternative splicing of LEF1 in T cells is controlled by CELF2.
More...