Property Summary

NCBI Gene PubMed Count 48
PubMed Score 43.07
PubTator Score 35.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 2.4
Rheumatoid arthritis 1191 0.0 0.8

Expression

  Differential Expression (36)

Disease log2 FC p
active Crohn's disease 1.338 4.3e-03
acute quadriplegic myopathy 1.300 1.1e-06
adult high grade glioma -1.500 2.0e-03
Amyotrophic lateral sclerosis 1.348 2.5e-06
Astrocytoma, Pilocytic -1.100 6.4e-04
atypical teratoid / rhabdoid tumor -1.400 2.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.231 3.3e-03
Breast cancer -1.300 4.6e-07
breast carcinoma -1.500 1.9e-04
chronic kidney disease 1.200 4.2e-02
cystic fibrosis 1.009 2.6e-04
dermatomyositis 1.100 1.1e-02
diabetes mellitus -1.200 1.1e-02
Duchenne muscular dystrophy 1.166 2.8e-06
ductal carcinoma in situ -1.400 2.6e-03
fibroadenoma -1.300 3.1e-03
glioblastoma -1.500 7.5e-06
group 4 medulloblastoma -1.100 1.9e-02
intraductal papillary-mucinous carcinoma... -2.300 8.8e-03
intraductal papillary-mucinous neoplasm ... -1.700 2.8e-02
invasive ductal carcinoma -1.900 1.3e-03
juvenile dermatomyositis 1.192 2.8e-11
lung adenocarcinoma -1.100 2.1e-09
lung cancer -1.400 5.7e-03
lung carcinoma -3.000 1.3e-47
medulloblastoma, large-cell -1.200 2.8e-03
non-small cell lung cancer -1.780 5.8e-18
osteosarcoma -2.220 6.7e-05
ovarian cancer -3.000 6.2e-13
pituitary cancer -1.600 1.2e-04
posterior fossa group A ependymoma -1.200 1.2e-05
primary Sjogren syndrome 1.100 7.2e-03
primitive neuroectodermal tumor -1.400 6.7e-04
psoriasis -1.100 8.1e-05
ulcerative colitis 1.300 1.5e-05
Waldenstrons macroglobulinemia 1.464 1.9e-03

Gene RIF (27)

AA Sequence

MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQIN      1 - 70
VLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVS     71 - 140
KKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFA    141 - 210
DTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQL    211 - 280
QNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVG    281 - 350
LNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP    351 - 420
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIG    421 - 490
MKRLKVQLKRSKNDSKPY                                                        491 - 508
//

Text Mined References (59)

PMID Year Title