Property Summary

NCBI Gene PubMed Count 24
PubMed Score 6.43
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.100 0.004
tuberculosis and treatment for 6 months 1.300 0.003
group 4 medulloblastoma 1.200 0.026
aldosterone-producing adenoma -1.020 0.014
subependymal giant cell astrocytoma -1.537 0.003
Pick disease -1.400 0.000
ovarian cancer 2.000 0.000

Synonym

Accession O95299 Q8WXC9
Symbols CI-42k
CI-42KD

Gene

PANTHER Protein Class (3)

Gene RIF (7)

PMID Text
22461910 NDUFA10 was found to be differentially methylated and expressed in human squamous cell carcinomas.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (NDUFA10) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGK      1 - 70
GKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRL     71 - 140
LQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP    141 - 210
VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDK    211 - 280
GPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDK    281 - 350
WIWLK                                                                     351 - 355
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25412178 2014 The complex I subunit NDUFA10 selectively rescues Drosophila pink1 mutants through a mechanism independent of mitophagy.
24652937 2014 PINK1 loss-of-function mutations affect mitochondrial complex I activity via NdufA10 ubiquinone uncoupling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23910658 2013 Identification of regions associated with variation in sensitivity to food-related odors in the human genome.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21150889 2011 NDUFA10 mutations cause complex I deficiency in a patient with Leigh disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...