Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 7.79
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Leigh disease 100 3.735 1.9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 4.031 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.020 1.4e-02
glioblastoma -1.100 3.7e-03
group 4 medulloblastoma 1.200 2.6e-02
ovarian cancer 2.000 4.0e-05
Pick disease -1.400 2.8e-07
subependymal giant cell astrocytoma -1.537 3.3e-03
tuberculosis and treatment for 6 months 1.300 2.8e-03

Gene RIF (7)

AA Sequence

MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGK      1 - 70
GKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRL     71 - 140
LQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP    141 - 210
VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDK    211 - 280
GPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDK    281 - 350
WIWLK                                                                     351 - 355
//

Text Mined References (28)

PMID Year Title