Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $32,293.34
PubMed Score 14.32
PubTator Score 8.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.100 0.005
breast carcinoma 1.200 0.001

Synonym

Accession O95298 E9PNU8 E9PRB2 Q549M5 Q6FIH8 Q9UBJ9
Symbols HLC-1
B14.5b
NADHDH2
CI-B14.5b

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (10)

PMID Text
25804238 Expression profiling of SCN8A and NDUFC2 genes in colorectal carcinoma is reported. There was no NDUFC2 differential expression in colorectal carcinoma.
23028138 DNA methylation of genes in retinol metabolism and calcium signaling pathways (P < 3 x 10-6) and with known functions in muscle and T2D including MEF2A, RUNX1, NDUFC2, and THADA decreased after exercise
21509594 NDUFC2 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFA      1 - 70
GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR                          71 - 119
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25804238 2015 Expression profiling of SCN8A and NDUFC2 genes in colorectal carcinoma.
23028138 2012 Impact of an exercise intervention on DNA methylation in skeletal muscle from first-degree relatives of patients with type 2 diabetes.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
More...