Property Summary

NCBI Gene PubMed Count 26
PubMed Score 22.45
PubTator Score 11.14

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

Gene RIF (11)

AA Sequence

MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLT      1 - 70
SVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNP     71 - 140
PDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLS    141 - 210
PVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN               211 - 269
//

Text Mined References (37)

PMID Year Title