Property Summary

NCBI Gene PubMed Count 39
Grant Count 50
R01 Count 17
Funding $4,961,246.75
PubMed Score 49.08
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (14)

PMID Text
26687946 Disruption of Snapin-PKR2 interaction did not affect PKR2 signaling, but increased the ligand-induced degradation, implying a role of Snapin in the trafficking of PKR2.
24751478 Authors propose that Snapin connects chlamydial inclusions with the microtubule network by interacting with both Chlamydia psittaci IncB and dynein.
23949442 Snapin, a SNAP-25 (synaptosomal-associated protein-25) interacting protein, interacts with LRRK2.
22797916 Our findings reveal that Atg14L, previously considered to be solely a Beclin 1-binding autophagy protein, plays a novel role in the late stage of endocytic trafficking in conjunction with Snapin
22523426 These observations identify Snapin as a novel endogenous TLR2 ligand in rheumatoid arthritis, and thus support a role for persistent TLR2 signalling in pathogenesis.
21917956 These results suggest that Snapin may play a key role in regulating the cellular localization of human cytomegalovirus UL70, leading to modulation of viral DNA synthesis and progeny production.
21356520 PKA-dependent phosphorylation of snapin increases interaction among insulin secretory vesicle-associated proteins, thereby potentiating glucose-stimulated insulin secretion.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19515809 Snapin plays an important role as a linker between the water channel and the t-SNARE complex, leading to the fusion event, and the pairing with specific t-SNAREs is essential for the specificity of membrane recognition and fusion.
19168546 Data describe for the first time the expression of SNAPIN in germ cells which raises possibility that SNAPIN plays an extra role in mammals which is germ cell specific.
More...

AA Sequence

MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINE      1 - 70
DQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK         71 - 136
//

Text Mined References (49)

PMID Year Title
26687946 2016 Snapin interacts with G-protein coupled receptor PKR2.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
24751478 2014 Chlamydia psittaci inclusion membrane protein IncB associates with host protein Snapin.
23949442 2013 LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797916 2012 Beclin-1-interacting autophagy protein Atg14L targets the SNARE-associated protein Snapin to coordinate endocytic trafficking.
22523426 2012 SNAPIN: an endogenous Toll-like receptor ligand in rheumatoid arthritis.
More...