Property Summary

NCBI Gene PubMed Count 43
PubMed Score 50.93
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (18)

AA Sequence

MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINE      1 - 70
DQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK         71 - 136
//

Text Mined References (53)

PMID Year Title