Property Summary

NCBI Gene PubMed Count 28
PubMed Score 55.87
PubTator Score 23.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-02
astrocytoma -1.500 2.1e-37
Astrocytoma, Pilocytic -1.300 1.6e-04
atypical teratoid / rhabdoid tumor -1.300 4.8e-05
ependymoma -1.200 4.8e-03
esophageal adenocarcinoma -1.400 2.7e-02
glioblastoma -1.100 2.4e-05
group 3 medulloblastoma -1.900 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 4.1e-03
medulloblastoma, large-cell -1.500 6.7e-03
oligodendroglioma -1.500 1.0e-26
ovarian cancer 1.300 1.2e-08
Pick disease -1.700 3.5e-05
primitive neuroectodermal tumor -1.700 3.3e-04
tuberculosis -1.300 4.1e-05

Gene RIF (22)

AA Sequence

MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVHLPLDFHQLAF      1 - 70
YVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEICLSVQMLEDGQGRCLRCHVL     71 - 140
QARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHWDEVLELREMPGAPSPLRVELWDWDMVGKND    141 - 210
FLGMVEFSPKTLQQKPPKGWFRLLPFPRAEEDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQG    211 - 280
PAEEDTASPLALLEELTLGDCRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKS    281 - 350
MEQFMKLVGMPYLHEVLKPVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLG    351 - 420
PIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQDVKYLAISGFLFLRFFAPAILTPKLFDLRDQH    421 - 490
ADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVRDFLDRLVDVDGDEAGVPARAL    491 - 560
FPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLSGETLSFSKSPEWQMCHSIPVSHIRAVERVDEGAF    561 - 630
QLPHVMQVVTQDGTGALHTTYLQCKNVNELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERS    631 - 700
AAGCSRTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRA    701 - 770
ATARLLEVLADLDRAHEEFQQQERGKAALGPLGP                                        771 - 804
//

Text Mined References (30)

PMID Year Title