Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
R01 Count 5
Funding $2,065,632.67
PubMed Score 48.26
PubTator Score 23.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -1.200 0.005
esophageal adenocarcinoma -1.400 0.027
astrocytoma -1.500 0.000
glioblastoma multiforme -1.500 0.000
oligodendroglioma -1.500 0.000
group 3 medulloblastoma -1.900 0.003
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.500 0.007
primitive neuroectodermal tumor -1.700 0.000
tuberculosis -1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.004
pediatric high grade glioma -1.100 0.001
pilocytic astrocytoma -1.300 0.000
Pick disease -1.700 0.000
ovarian cancer 1.300 0.000

Gene RIF (17)

PMID Text
26997440 Report a new subtype of high-grade mandibular osteosarcoma with RASAL1/MDM2 amplification.
26008146 These findings suggest that Ebp1 suppressed thyroid cancer cell lines by upregulating RASRAL expression.
25735335 Loss of RASAL1 expression is associated with gastric carcinogenesis.
25616414 Transcriptional suppression of RASAL1 through aberrant promoter methylation contributes to endothelial-mesenchymal transition and ultimately to progression of cardiac fibrosis.
24925056 large chromosome 12 rearrangement, spanning MDM2 and RASAL1, is the first recurrent molecular abnormality to be reported in juvenile ossifying fibroma
24712574 Germline RASAL1 alterations are uncommon in patients with Cowden syndrome but may not be infrequent in patients with apparently sporadic follicular-variant papillary thyroid cancer.
24531877 It is a tumor suppressor gene which influences the proliferation and invasion of gastric cancer by regulating RAS/ERK signaling pathway.
24377515 Promoter hypermethylation of the RASAL1 gene was detected in MKN-28, SGC-790l and BGC-823 cancer cells.
24136889 We identified RASAL1 as a major tumor suppressor gene that is frequently inactivated by hypermethylation and mutations, providing a new alternative genetic background for thyroid cancer, particularly FTC and ATC.
23665422 Hypermethylations of RASAL1 and KLOTHO is associated with renal dysfunction in a Chinese population environmentally exposed to cadmium
More...

AA Sequence

MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVHLPLDFHQLAF      1 - 70
YVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEICLSVQMLEDGQGRCLRCHVL     71 - 140
QARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHWDEVLELREMPGAPSPLRVELWDWDMVGKND    141 - 210
FLGMVEFSPKTLQQKPPKGWFRLLPFPRAEEDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQG    211 - 280
PAEEDTASPLALLEELTLGDCRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKS    281 - 350
MEQFMKLVGMPYLHEVLKPVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLG    351 - 420
PIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQDVKYLAISGFLFLRFFAPAILTPKLFDLRDQH    421 - 490
ADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVRDFLDRLVDVDGDEAGVPARAL    491 - 560
FPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLSGETLSFSKSPEWQMCHSIPVSHIRAVERVDEGAF    561 - 630
QLPHVMQVVTQDGTGALHTTYLQCKNVNELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERS    631 - 700
AAGCSRTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRA    701 - 770
ATARLLEVLADLDRAHEEFQQQERGKAALGPLGP                                        771 - 804
//

Text Mined References (25)

PMID Year Title
26997440 2016 A new subtype of high-grade mandibular osteosarcoma with RASAL1/MDM2 amplification.
26008146 2015 EBP1 suppresses growth, migration, and invasion of thyroid cancer cells through upregulating RASAL expression.
25735335 2015 RASAL1 attenuates gastric carcinogenesis in nude mice by blocking RAS/ERK signaling.
25616414 2015 Epigenetic balance of aberrant Rasal1 promoter methylation and hydroxymethylation regulates cardiac fibrosis.
24925056 2015 Chromosome 12 long arm rearrangement covering MDM2 and RASAL1 is associated with aggressive craniofacial juvenile ossifying fibroma and extracranial psammomatoid fibro-osseous lesions.
24712574 2014 Germline alterations in RASAL1 in Cowden syndrome patients presenting with follicular thyroid cancer and in individuals with apparently sporadic epithelial thyroid cancer.
24531877 2014 RASAL1 influences the proliferation and invasion of gastric cancer cells by regulating the RAS/ERK signaling pathway.
24377515 2013 Hypermethylation and clinicopathological significance of RASAL1 gene in gastric cancer.
24136889 2013 Identification of RASAL1 as a major tumor suppressor gene in thyroid cancer.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
More...