Property Summary

NCBI Gene PubMed Count 81
Grant Count 29
R01 Count 5
Funding $2,570,094.56
PubMed Score 168.24
PubTator Score 95.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.001
astrocytic glioma -1.200 0.046
psoriasis -1.500 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.003
medulloblastoma, large-cell -1.500 0.000
cystic fibrosis -1.200 0.000
pediatric high grade glioma -1.200 0.000
invasive ductal carcinoma -1.200 0.001
ovarian cancer 1.800 0.000

Gene RIF (53)

PMID Text
26812496 The VAPB and its interacting partners cooperatively regulate protein trafficking through the ERGIC by modulating PtdIns4P levels.
26784321 Study characterizes the human VAPB-HCV NS5B interaction and reveals that NS5B C-linker is intrinsically disordered in solution but capable of binding the human VAPB-MSP domain which overlaps with those for binding HCV NS5A and human Eph receptors.
26740627 VAPB inhibited the degradation of DeltaF508-CFTR in the ER through interactions with the RMA1-Derlin-BAP31-VCP pathway.
26490117 Our work revealed that VAP-A/B knockdown impaired the processing and secretion of PAUF, which is one of the cargo proteins of carriers of the trans-Golgi network to the cell surface.
26362257 Heterozygous P56S Vapb knock-in mice show mild age-dependent defects in motor behaviors as characteristic features of the disease. The homozygous P56S Vapb knock-in mice show more severe defects compared with heterozygous mice reflecting the dominant and dose-dependent effects of P56S mutation.
25826266 Collectively, these results not only lead to a better understanding of hVAPB function but also point to potentially relevant targets for therapeutic intervention.
25824044 P56S-VAPB was found to suppress adipocyte differentiation by promoting the activation of the ATF4-CHOP pathway
25612670 results suggest that the binding of vesicle-associated membrane protein-associated protein B(VAP-B) to Rab3 GTPase activating protein 1(RAB3GAP1) is implicated in the regulation of nuclear envelope formation through ER-Golgi intermediate compartment
24885147 The repertoire of VAPB interactors is more diverse than previously anticipated and link VAPB to the function of ATPase complexes such as p97/FAF1 and ASNA1/transmembrane-domain recognition complex.
24212516 genetic screening for this mutation should be performed in all adult patients with lower motor neuron disease, regardless of family history because of the rarity of this disease, physicians often do not suspect it, and many cases may be missed in Brazil.
More...

AA Sequence

MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVS      1 - 70
VMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI     71 - 140
ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISA    141 - 210
LAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL                                         211 - 243
//

Text Mined References (90)

PMID Year Title
26812496 2016 Oxysterol-binding protein ORP3 rescues the Amyotrophic Lateral Sclerosis-linked mutant VAPB phenotype.
26784321 2016 C-Terminal Auto-Regulatory Motif of Hepatitis C Virus NS5B Interacts with Human VAPB-MSP to Form a Dynamic Replication Complex.
26740627 2016 VAMP-associated Proteins (VAP) as Receptors That Couple Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) Proteostasis with Lipid Homeostasis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490117 2015 CARTS biogenesis requires VAP-lipid transfer protein complexes functioning at the endoplasmic reticulum-Golgi interface.
26362257 2015 Vapb/Amyotrophic lateral sclerosis 8 knock-in mice display slowly progressive motor behavior defects accompanying ER stress and autophagic response.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25826266 2015 Network analyses reveal novel aspects of ALS pathogenesis.
25824044 2015 ALS-associated P56S-VAPB mutation restrains 3T3-L1 preadipocyte differentiation.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
More...