Property Summary

NCBI Gene PubMed Count 89
PubMed Score 169.42
PubTator Score 95.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 4.6e-02
atypical teratoid / rhabdoid tumor -1.500 6.0e-08
cystic fibrosis -1.200 1.4e-04
gastric cancer 1.100 1.4e-03
glioblastoma -1.400 3.4e-03
invasive ductal carcinoma -1.200 8.3e-04
medulloblastoma, large-cell -1.500 1.3e-05
ovarian cancer -1.100 1.5e-04
pediatric high grade glioma -1.200 4.1e-04
psoriasis -1.500 6.1e-05

Gene RIF (58)

AA Sequence

MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVS      1 - 70
VMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI     71 - 140
ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISA    141 - 210
LAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL                                         211 - 243
//

Text Mined References (98)

PMID Year Title