Tbio | Potassium channel subfamily K member 5 |
pH-dependent, voltage insensitive, outwardly rectifying potassium channel. Outward rectification is lost at high external K(+) concentrations.
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. [provided by RefSeq, Jul 2008]
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Migraine Disorders | 26 |
Status Epilepticus | 85 |
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2714 | 5.24269908351632E-11 |
malignant mesothelioma | 3163 | 1.75430182323267E-6 |
cystic fibrosis | 1670 | 2.99277409205335E-5 |
lung cancer | 4473 | 9.46161990854213E-5 |
osteosarcoma | 7933 | 1.43194284656241E-4 |
ulcerative colitis | 2087 | 3.68267877653633E-4 |
adrenocortical carcinoma | 1427 | 6.62485442105358E-4 |
psoriasis | 6685 | 0.00106472379932359 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.01518822055671 |
active Crohn's disease | 918 | 0.0442544348194169 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Interstitial nephritis | 6 | 4.037 | 2.0 |
Renal tubular acidosis | 14 | 3.043 | 1.5 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 2.000 | 0.000 |
psoriasis | -2.500 | 0.001 |
osteosarcoma | -1.982 | 0.000 |
adrenocortical carcinoma | -1.221 | 0.001 |
intraductal papillary-mucinous adenoma (... | 1.100 | 0.015 |
lung cancer | -1.700 | 0.000 |
active Crohn's disease | -1.219 | 0.044 |
cystic fibrosis | -2.000 | 0.000 |
lung adenocarcinoma | 1.500 | 0.000 |
ulcerative colitis | -1.100 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | EggNOG Inparanoid |
PMID | Text |
---|---|
26140335 | Potassium channel TASK2 drives human NK-cell proliferation and cytolytic function. |
24949484 | Mutant genes (CELA1, HSPG2, and KCNK5) in Balkan endemic nephropathy patients encode proteins involved in basement membrane/extracellular matrix and vascular tone, tightly connected to process of angiogenesis. |
24285684 | The TASK-2 channel lower expression represents a hallmark of aldosterone-producing adenoma causing aldosteronism and is associated with a higher expression of hsa-miR-23 and hsa-miR-34. |
21964404 | Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells |
21680658 | 17beta-estradiol induces the expression of KCNK5 via ERalpha(+) in breast cancer cells, and this channel plays a role in regulating proliferation in these cell lines. |
21314928 | Disease activity in rheumatoid arthritis patients correlates strongly with K(2P)5.1 expression levels in CD4+ T lymphocytes in the peripheral blood |
20631251 | Data suggest that the cytokine receptor-coupled JAK/STAT pathway is upstream of the swelling-induced phosphorylation and activation of TASK-2 in Ehrlich ascites tumor cells. |
20582984 | We here identify and characterize K2P5.1 as a critical player of T-cell effector function; selective targeting of K(2P)5.1 may hold therapeutic promise for multiple sclerosis and putatively other T-cell-mediated disorders. |
18157847 | KCNK5 is involved K(+)-channel in regulatory volume decrease in human spermatozoa, and channel activity is regulated beyond the extent of protein expression. |
15197476 | TASK-2 is not highly expressed in cerebellum |
More... |
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQ 1 - 70 GVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGR 71 - 140 AKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFV 141 - 210 AGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVK 211 - 280 GSTASKDVNIFSFLSKKEETYNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKN 281 - 350 RVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI 351 - 420 TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELSVPYEQLMNEY 421 - 490 NKANSPKGT 491 - 499 //
PMID | Year | Title |
---|---|---|
26140335 | 2015 | The two-pore domain K2 P channel TASK2 drives human NK-cell proliferation and cytolytic function. |
24949484 | 2014 | NGS nominated CELA1, HSPG2, and KCNK5 as candidate genes for predisposition to Balkan endemic nephropathy. |
24564958 | 2014 | Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence. |
24285684 | 2014 | Lower expression of the TWIK-related acid-sensitive K+ channel 2 (TASK-2) gene is a hallmark of aldosterone-producing adenoma causing human primary aldosteronism. |
23793025 | 2013 | Genome-wide meta-analysis identifies new susceptibility loci for migraine. |
23568457 | 2013 | Genetic variants associated with disordered eating. |
23251661 | 2012 | Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population. |
21964404 | 2012 | A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells. |
21680658 | 2011 | The two-pore domain potassium channel KCNK5: induction by estrogen receptor alpha and role in proliferation of breast cancer cells. |
21314928 | 2011 | Expression of K2P5.1 potassium channels on CD4+ T lymphocytes correlates with disease activity in rheumatoid arthritis patients. |
More... |