Property Summary

Ligand Count 2
NCBI Gene PubMed Count 29
PubMed Score 76.86
PubTator Score 188.86

Knowledge Summary

Patent (3,067)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.219 4.4e-02
adrenocortical carcinoma -1.221 6.6e-04
cystic fibrosis -2.000 3.0e-05
intraductal papillary-mucinous adenoma (... 1.100 1.5e-02
lung adenocarcinoma 1.500 5.2e-11
lung cancer -1.700 9.5e-05
malignant mesothelioma 2.000 1.8e-06
osteosarcoma -1.982 1.4e-04
psoriasis -1.400 8.7e-08
ulcerative colitis -1.100 3.7e-04

Gene RIF (15)

AA Sequence

MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQ      1 - 70
GVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGR     71 - 140
AKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFV    141 - 210
AGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVK    211 - 280
GSTASKDVNIFSFLSKKEETYNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKN    281 - 350
RVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI    351 - 420
TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELSVPYEQLMNEY    421 - 490
NKANSPKGT                                                                 491 - 499
//

Text Mined References (31)

PMID Year Title