Property Summary

NCBI Gene PubMed Count 25
Grant Count 1
Funding $99,930
PubMed Score 70.05
PubTator Score 188.86

Knowledge Summary

Patent (3,067)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
psoriasis -2.500 0.001
osteosarcoma -1.982 0.000
adrenocortical carcinoma -1.221 0.001
intraductal papillary-mucinous adenoma (... 1.100 0.015
lung cancer -1.700 0.000
active Crohn's disease -1.219 0.044
cystic fibrosis -2.000 0.000
lung adenocarcinoma 1.500 0.000
ulcerative colitis -1.100 0.000

Synonym

Accession O95279 B2RAQ6 B5TJL2 Q5VV76
Symbols TASK2
K2p5.1
KCNK5b
TASK-2

Gene

 Grant Application (1)

Gene RIF (11)

PMID Text
26140335 Potassium channel TASK2 drives human NK-cell proliferation and cytolytic function.
24949484 Mutant genes (CELA1, HSPG2, and KCNK5) in Balkan endemic nephropathy patients encode proteins involved in basement membrane/extracellular matrix and vascular tone, tightly connected to process of angiogenesis.
24285684 The TASK-2 channel lower expression represents a hallmark of aldosterone-producing adenoma causing aldosteronism and is associated with a higher expression of hsa-miR-23 and hsa-miR-34.
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
21680658 17beta-estradiol induces the expression of KCNK5 via ERalpha(+) in breast cancer cells, and this channel plays a role in regulating proliferation in these cell lines.
21314928 Disease activity in rheumatoid arthritis patients correlates strongly with K(2P)5.1 expression levels in CD4+ T lymphocytes in the peripheral blood
20631251 Data suggest that the cytokine receptor-coupled JAK/STAT pathway is upstream of the swelling-induced phosphorylation and activation of TASK-2 in Ehrlich ascites tumor cells.
20582984 We here identify and characterize K2P5.1 as a critical player of T-cell effector function; selective targeting of K(2P)5.1 may hold therapeutic promise for multiple sclerosis and putatively other T-cell-mediated disorders.
18157847 KCNK5 is involved K(+)-channel in regulatory volume decrease in human spermatozoa, and channel activity is regulated beyond the extent of protein expression.
15197476 TASK-2 is not highly expressed in cerebellum
More...

AA Sequence

MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQ      1 - 70
GVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGR     71 - 140
AKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFV    141 - 210
AGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVK    211 - 280
GSTASKDVNIFSFLSKKEETYNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKN    281 - 350
RVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI    351 - 420
TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELSVPYEQLMNEY    421 - 490
NKANSPKGT                                                                 491 - 499
//

Text Mined References (27)

PMID Year Title
26140335 2015 The two-pore domain K2 P channel TASK2 drives human NK-cell proliferation and cytolytic function.
24949484 2014 NGS nominated CELA1, HSPG2, and KCNK5 as candidate genes for predisposition to Balkan endemic nephropathy.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24285684 2014 Lower expression of the TWIK-related acid-sensitive K+ channel 2 (TASK-2) gene is a hallmark of aldosterone-producing adenoma causing human primary aldosteronism.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23568457 2013 Genetic variants associated with disordered eating.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
21680658 2011 The two-pore domain potassium channel KCNK5: induction by estrogen receptor alpha and role in proliferation of breast cancer cells.
21314928 2011 Expression of K2P5.1 potassium channels on CD4+ T lymphocytes correlates with disease activity in rheumatoid arthritis patients.
More...