Property Summary

NCBI Gene PubMed Count 77
PubMed Score 282.51
PubTator Score 120.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (49)

AA Sequence

MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLWLGEVELAAEE      1 - 70
AAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMK     71 - 140
HTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPE    141 - 210
PMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGW    211 - 280
LQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFFQKFGKVRSSVCSL                       281 - 331
//

Text Mined References (83)

PMID Year Title