Property Summary

NCBI Gene PubMed Count 29
Grant Count 49
R01 Count 18
Funding $3,780,187.46
PubMed Score 34.93
PubTator Score 23.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 0.021
osteosarcoma -1.817 0.006
primary pancreatic ductal adenocarcinoma 1.131 0.002
lung adenocarcinoma -1.400 0.000
acute myeloid leukemia -1.100 0.027
ovarian cancer -2.600 0.000
pancreatic cancer 1.100 0.005

Gene RIF (11)

PMID Text
26107195 GCIP underexpression is associated with Osteosarcoma.
26002959 Data suggest MAID/CCNDBP1 inhibits cell migration induced by TGFB1 (transforming growth factor-beta1) but not by BMP4 (bone morphogenetic protein-4); MAID does not alter cell proliferation, epithelial-mesenchymal transition, or TGFB3-induced apoptosis.
24970809 Data indicate that grap2 and cyclin D1 interacting protein (GCIP) and inhibitor of of DNA binding/differentiation 1 (Id1) are inversely expressed in non-small cell lung cancer (NSCLC) cell lines and specimens.
22453338 The first structure of a free-standing human dominant-negative helix-loop-helix protein (DIP1) was reported. DIP1 adopts a V-shaped conformation, with N-terminal and C-terminal five-helix bundles connected by the HLH region.
20460530 It is proposed for the first time that Rad may promote carcinogenesis at least in part by inhibiting GCIP-mediated tumor suppression.
19153449 Crystallization and preliminary X-ray diffraction analysis of GCIP/HHM transcriptional regulator
18983464 decreased expression of GCIP in vivo is present in human breast carcinoma.
18923419 Data suggest that HHM/Maid regulates a subset of TGF-beta target genes including the Olig1-Smad synexpression group.
17621266 P0 overexpression may cause tumorigenesis in breast and liver tissues at least in part by inhibiting GCIP-mediated tumor suppression.
17532760 CT847 interacts with mammalian Grap2 cyclin D-interacting protein
More...

AA Sequence

MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTL      1 - 70
TIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTP     71 - 140
TQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEE    141 - 210
NNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDI    211 - 280
SDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRI    281 - 350
KELTQSELEL                                                                351 - 360
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26107195 2015 miR-9 Modulates Osteosarcoma Cell Growth by Targeting the GCIP Tumor Suppressor.
26002959 2015 Maid is a negative regulator of transforming growth factor-?-induced cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
24970809 2014 GCIP functions as a tumor suppressor in non-small cell lung cancer by suppressing Id1-mediated tumor promotion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22453338 2012 Structure of a dominant-negative helix-loop-helix transcriptional regulator suggests mechanisms of autoinhibition.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20460530 2010 A novel senescence-evasion mechanism involving Grap2 and Cyclin D interacting protein inactivation by Ras associated with diabetes in cancer cells under doxorubicin treatment.
19153449 2009 Crystallization and preliminary X-ray diffraction analysis of GCIP/HHM transcriptional regulator.
More...