Property Summary

NCBI Gene PubMed Count 32
PubMed Score 37.53
PubTator Score 23.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 2.7e-02
astrocytic glioma -1.400 2.1e-02
lung adenocarcinoma -1.400 7.6e-11
osteosarcoma -1.817 6.1e-03
ovarian cancer -2.600 2.2e-09
pancreatic cancer 1.100 5.3e-03
primary pancreatic ductal adenocarcinoma 1.131 2.5e-03

Gene RIF (11)

AA Sequence

MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTL      1 - 70
TIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTP     71 - 140
TQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEE    141 - 210
NNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDI    211 - 280
SDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRI    281 - 350
KELTQSELEL                                                                351 - 360
//

Text Mined References (36)

PMID Year Title