Property Summary

NCBI Gene PubMed Count 85
Grant Count 42
R01 Count 28
Funding $2,492,988.25
PubMed Score 107.55
PubTator Score 574.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.019 0.005
non primary Sjogren syndrome sicca -1.300 0.019
ovarian cancer -2.500 0.000
dermatomyositis 1.200 0.000

Gene RIF (57)

PMID Text
26845027 TNKS1 is recruited to DNA lesions by MDC1 and promotes homologous recombination in response to DNA double strand breaks.
26729153 HCMV modulates the activity of TNKS to induce Axin1, resulting in inhibition of the beta-catenin pathway.
26617760 TNKS1 SNPs (rs11991621 rs10503380, and rs7015700) were associated with non-small cell lung cance risk, whereas rs6601328 and rs12541709 inversely associated with risk
26513298 Data show that E7449 represents a dual Poly(ADP-ribose) Polymerase 1/2 and tankyrase 1/2 inhibitor which has the advantage of targeting Wnt/beta-catenin signaling addicted tumors.
26246473 Tankyrase inhibition is a potential therapeutic approach for treating a subgroup HCC with aberrant WNT/beta-catenin signaling pathway.
25939383 Data indicate that tankyrase (Tnks) inhibitors impact telomere length maintenance independently of their affects on Wnt/beta-catenin signaling.
25880085 Copy number deletion on TNKS was associated with a 1.37-fold decreased risk for osteoarthritis.
25876076 tankyrase-mediated PARsylation is promoted by nutritional energy stimulated NAD+ in insulinoma cells
24747911 A novel function of TNKS in the relief of a feedback loop induced by MEK inhibition on FGFR2 signaling pathway.
24419084 This limits the therapeutic value of TNKSi in colorectal carcinomas.
More...

AA Sequence

MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDG      1 - 70
SRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSS     71 - 140
SSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAK    141 - 210
DMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDN    211 - 280
WNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEK    281 - 350
LMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL    351 - 420
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKG    421 - 490
HSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMT    491 - 560
PLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQM    561 - 630
GNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVV    631 - 700
EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLL    701 - 770
KHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP    771 - 840
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEA    841 - 910
AQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPA    911 - 980
STPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE    981 - 1050
QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQS   1051 - 1120
VEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFIN   1121 - 1190
AIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF   1191 - 1260
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT      1261 - 1327
//

Text Mined References (89)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26845027 2016 Tankyrases Promote Homologous Recombination and Check Point Activation in Response to DSBs.
26729153 2015 Human Cytomegalovirus Inhibits the PARsylation Activity of Tankyrase--A Potential Strategy for Suppression of the Wnt Pathway.
26617760 2015 Tankyrase 1 polymorphism associated with an increased risk in developing non-small cell lung cancer in a Chinese population: a proof-of-principle study.
26513298 2015 E7449: A dual inhibitor of PARP1/2 and tankyrase1/2 inhibits growth of DNA repair deficient tumors and antagonizes Wnt signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26373281 2015 Loss of ATRX Suppresses Resolution of Telomere Cohesion to Control Recombination in ALT Cancer Cells.
26246473 2015 Tankyrase inhibitors attenuate WNT/?-catenin signaling and inhibit growth of hepatocellular carcinoma cells.
25939383 2015 Disruption of Wnt/?-Catenin Signaling and Telomeric Shortening Are Inextricable Consequences of Tankyrase Inhibition in Human Cells.
25880085 2015 A genome-wide association study of copy-number variation identifies putative loci associated with osteoarthritis in Koreans.
More...