Tchem | 5-hydroxytryptamine receptor 3B |
The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 2.37339688642629E-48 |
ovarian cancer | 8492 | 8.71877072112003E-9 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Heroin dependence | 30 | 4.052 | 2.0 |
Irritable bowel syndrome | 59 | 3.857 | 1.9 |
Alcohol dependence | 107 | 3.481 | 1.7 |
Nicotine dependence | 53 | 3.46 | 1.7 |
Schizophrenia | 503 | 3.341 | 1.7 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
tropisetron
pKi 8.80
ondansetron
pKi 8.30
palonosetron
pKd 9.74
granisetron
pKi 8.80
cisapride
pKi 6.82
metoclopramide
pKd 7.30
PMID | Text |
---|---|
26256989 | The response to ondansetron for PONV was significantly influenced by the -100_-102AAG deletion polymorphisms of the 5-HT3B gene. Thus, the -100_-102AAG deletion variants may be a pharmacogenetic predictor for responsiveness to ondansetron for PONV. |
25951416 | Study demonstrates that the 5-HT3Br1 transcriptional variant of the 5-HT3B subunit can contribute to the functional properties of heteromeric receptors in a similar manner to the originally characterized 5-HT3B subunit |
24880582 | we found an association of the HTR3B with poor concentration in schizophrenia patients.These results suggest that the HTR3B may be involved in the attention problem of schizophrenia in Korean population. |
24590108 | variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence |
24244382 | This is the first study to show an association between 5-HTR3B and PCS scores, thus suggesting a role of the serotonin pathway in pain catastrophizing. |
23972841 | the stoichiometry of 5-HT3AB receptors on the plasma membrane |
23897038 | Polymorphisms in the HTR3B gene are predictors of reduced alcohol drinking in response to ondansetron. |
23810831 | The ability of 5-HT to gate the homomeric or heteromeric receptor appears to rely on the D loop triplet RQY of the complementary face. |
23786674 | HTR3B gene variants may contribute to variability in severity of and response to antiemetic therapy for nausea and vomiting of pregnancy. |
23757001 | Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes. |
More... |
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILD 1 - 70 VDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSS 71 - 140 GTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELL 141 - 210 SVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVG 211 - 280 YTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADR 281 - 350 PRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY 351 - 420 LFMLGIYTITLCSLWALWGGV 421 - 441 //
PMID | Year | Title |
---|---|---|
26256989 | 2015 | Association of 5-HT3B Receptor Gene Polymorphisms with the Efficacy of Ondansetron for Postoperative Nausea and Vomiting. |
25951416 | 2015 | 5-HT3 Receptor Brain-Type B-Subunits are Differentially Expressed in Heterologous Systems. |
25217961 | 2014 | A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer. |
24880582 | 2014 | Association between promoter polymorphism (rs10789970) in 5-hydroxytryptamine receptor 3B and poor concentration in schizophrenia. |
24590108 | 2014 | Association and interaction analyses of 5-HT3 receptor and serotonin transporter genes with alcohol, cocaine, and nicotine dependence using the SAGE data. |
24244382 | 2013 | Polymorphism in serotonin receptor 3B is associated with pain catastrophizing. |
23972841 | 2013 | The 5-HT3AB receptor shows an A3B2 stoichiometry at the plasma membrane. |
23897038 | 2013 | Determination of genotype combinations that can predict the outcome of the treatment of alcohol dependence using the 5-HT(3) antagonist ondansetron. |
23810831 | 2013 | Importance of recognition loops B and D in the activation of human 5-HT? receptors by 5-HT and meta-chlorophenylbiguanide. |
23786674 | 2013 | Pharmacogenetic predictors of nausea and vomiting of pregnancy severity and response to antiemetic therapy: a pilot study. |
More... |