Property Summary

NCBI Gene PubMed Count 67
Grant Count 13
Funding $521,769.93
PubMed Score 41.39
PubTator Score 63.25

Knowledge Summary

Patent (3,068)

Gene RIF (68)

PMID Text
26256989 The response to ondansetron for PONV was significantly influenced by the -100_-102AAG deletion polymorphisms of the 5-HT3B gene. Thus, the -100_-102AAG deletion variants may be a pharmacogenetic predictor for responsiveness to ondansetron for PONV.
25951416 Study demonstrates that the 5-HT3Br1 transcriptional variant of the 5-HT3B subunit can contribute to the functional properties of heteromeric receptors in a similar manner to the originally characterized 5-HT3B subunit
24880582 we found an association of the HTR3B with poor concentration in schizophrenia patients.These results suggest that the HTR3B may be involved in the attention problem of schizophrenia in Korean population.
24590108 variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence
24244382 This is the first study to show an association between 5-HTR3B and PCS scores, thus suggesting a role of the serotonin pathway in pain catastrophizing.
23972841 the stoichiometry of 5-HT3AB receptors on the plasma membrane
23897038 Polymorphisms in the HTR3B gene are predictors of reduced alcohol drinking in response to ondansetron.
23810831 The ability of 5-HT to gate the homomeric or heteromeric receptor appears to rely on the D loop triplet RQY of the complementary face.
23786674 HTR3B gene variants may contribute to variability in severity of and response to antiemetic therapy for nausea and vomiting of pregnancy.
23757001 Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes.
More...

AA Sequence

MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILD      1 - 70
VDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSS     71 - 140
GTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELL    141 - 210
SVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVG    211 - 280
YTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADR    281 - 350
PRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY    351 - 420
LFMLGIYTITLCSLWALWGGV                                                     421 - 441
//

Text Mined References (71)

PMID Year Title
26256989 2015 Association of 5-HT3B Receptor Gene Polymorphisms with the Efficacy of Ondansetron for Postoperative Nausea and Vomiting.
25951416 2015 5-HT3 Receptor Brain-Type B-Subunits are Differentially Expressed in Heterologous Systems.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24880582 2014 Association between promoter polymorphism (rs10789970) in 5-hydroxytryptamine receptor 3B and poor concentration in schizophrenia.
24590108 2014 Association and interaction analyses of 5-HT3 receptor and serotonin transporter genes with alcohol, cocaine, and nicotine dependence using the SAGE data.
24244382 2013 Polymorphism in serotonin receptor 3B is associated with pain catastrophizing.
23972841 2013 The 5-HT3AB receptor shows an A3B2 stoichiometry at the plasma membrane.
23897038 2013 Determination of genotype combinations that can predict the outcome of the treatment of alcohol dependence using the 5-HT(3) antagonist ondansetron.
23810831 2013 Importance of recognition loops B and D in the activation of human 5-HT? receptors by 5-HT and meta-chlorophenylbiguanide.
23786674 2013 Pharmacogenetic predictors of nausea and vomiting of pregnancy severity and response to antiemetic therapy: a pilot study.
More...