Property Summary

Ligand Count 6
NCBI Gene PubMed Count 71
PubMed Score 42.02
PubTator Score 63.25

Knowledge Summary

Patent (3,068)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.300 8.7e-09
psoriasis 4.500 2.4e-48

 IMPC Phenotype (1)

Gene RIF (72)

AA Sequence

MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILD      1 - 70
VDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSS     71 - 140
GTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELL    141 - 210
SVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVG    211 - 280
YTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADR    281 - 350
PRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY    351 - 420
LFMLGIYTITLCSLWALWGGV                                                     421 - 441
//

Text Mined References (75)

PMID Year Title