Property Summary

NCBI Gene PubMed Count 32
PubMed Score 118.81
PubTator Score 46.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
ovarian cancer 8492 1.66471669223641E-21
non-small cell lung cancer 2798 2.31096305108317E-17
lung carcinoma 2844 1.28826253730624E-16
lung adenocarcinoma 2714 1.02191003996149E-12
atypical teratoid / rhabdoid tumor 4369 2.54299969301028E-8
sonic hedgehog group medulloblastoma 1482 3.92494955019176E-6
Breast cancer 3099 2.34582311581164E-5
medulloblastoma, large-cell 6234 1.06428739329579E-4
ductal carcinoma in situ 1745 0.00148403461341021
adrenocortical carcinoma 1427 0.00165923424649638
primitive neuroectodermal tumor 3031 0.00197709278415049
breast carcinoma 1614 0.00365362857092921
glioblastoma 5572 0.00444351175083816
chronic rhinosinusitis 512 0.00692384912319536
pituitary cancer 1972 0.00882939778112241
osteosarcoma 7933 0.00903780108377246
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0120043381400361
pilocytic astrocytoma 3086 0.0145963802631687
oligodendroglioma 2849 0.0158342720349199
astrocytic glioma 2241 0.0216589429730322
ependymoma 2514 0.0221281324910061
cystic fibrosis and chronic rhinosinusitis 213 0.0296623262616033
Disease Target Count Z-score Confidence
Hypothyroidism 89 0.0 1.0
Disease Target Count Z-score Confidence
Cushing's syndrome 47 3.672 1.8
Disease Target Count Z-score Confidence
Dystonia 77 4.109 2.1
Carney complex 23 4.019 2.0

Expression

  Differential Expression (22)

Synonym

Accession O95263 Q5J7V7 Q86XK8 Q8IUJ7 Q8IUJ8 Q8IUJ9 Q8IUK0 Q8N3T2 HsPDE8B
Symbols ADSD
PPNAD3

Gene

PANTHER Protein Class (2)

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

Gene RIF (21)

PMID Text
25822812 Genetic variation of the PDE8B gene may be involved in the etiology of subclinical hypothyroidism in pregnant women.
24497218 A prevalence of the minor allele of PDE8B gene polymorphism associated with elevated serum levels of TSH was demonstrated in patients affected by sporadic nonautoimmune subclinical hypothyroidism.
23941514 rs4704397 is associated with thyroid function, risk of MI, and body height.
23272636 rs4704397 in phosphodiesterase 8B is associated with thyrotropin and thyroid hormone concentrations
23237535 There is an association between homozygous A/A as well as homozygous G/G carriers of SNP rs 4704397 in PDE8B and recurrent miscarriage.
22781450 PDE8B gene polymorphisms may be correlated with hyperthyroxinemia in the Chinese Han population.
22335482 PDE8B is another PDE gene in which variations may contribute to predisposition of adrenocortical tumours.
22084153 In obese children, PDE8B is associated with TSH; the interaction between adiposity and PDE8B on TSH is not synergistic, but follows an additive model.
21317282 Common genetic variation in PDE8B is associated with reciprocal changes in thyroid hormone levels.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSVARVRRA      1 - 70
RTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAK     71 - 140
EDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQNFDAEAVCRSIRATNPSEHTVI    141 - 210
LAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHE    211 - 280
AIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRK    281 - 350
SGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV    351 - 420
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSP    421 - 490
QLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFN    491 - 560
IFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFF    561 - 630
LGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDT    631 - 700
KCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQI    701 - 770
LIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF    771 - 840
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS                             841 - 885
//

Text Mined References (36)

PMID Year Title
25822812 2015 Genetic association study of phosphodiesterase 8B gene with subclinical hypothyroidism in pregnant women.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24497218 2014 Frequency and effect on serum TSH of phosphodiesterase 8B (PDE8B) gene polymorphisms in patients with sporadic nonautoimmune subclinical hypothyroidism.
23941514 2014 The phosphodiesterase 8B gene rs4704397 is associated with thyroid function, risk of myocardial infarction, and body height: the Tromsø study.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23272636 2013 Associations of rs4704397 in phosphodiesterase 8B with thyrotropin and thyroid hormone concentrations.
23237535 2012 Phosphodiesterase 8B gene polymorphism in women with recurrent miscarriage: a retrospective case control study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22781450 2012 [Association analysis of PDE8B gene polymorphisms with the susceptibility to Hyperthyroxinemia in Chinese Han population].
22494929 2012 Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
More...