Property Summary

NCBI Gene PubMed Count 32
Grant Count 17
R01 Count 5
Funding $6,784,055.68
PubMed Score 118.81
PubTator Score 46.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (21)

PMID Text
25822812 Genetic variation of the PDE8B gene may be involved in the etiology of subclinical hypothyroidism in pregnant women.
24497218 A prevalence of the minor allele of PDE8B gene polymorphism associated with elevated serum levels of TSH was demonstrated in patients affected by sporadic nonautoimmune subclinical hypothyroidism.
23941514 rs4704397 is associated with thyroid function, risk of MI, and body height.
23272636 rs4704397 in phosphodiesterase 8B is associated with thyrotropin and thyroid hormone concentrations
23237535 There is an association between homozygous A/A as well as homozygous G/G carriers of SNP rs 4704397 in PDE8B and recurrent miscarriage.
22781450 PDE8B gene polymorphisms may be correlated with hyperthyroxinemia in the Chinese Han population.
22335482 PDE8B is another PDE gene in which variations may contribute to predisposition of adrenocortical tumours.
22084153 In obese children, PDE8B is associated with TSH; the interaction between adiposity and PDE8B on TSH is not synergistic, but follows an additive model.
21317282 Common genetic variation in PDE8B is associated with reciprocal changes in thyroid hormone levels.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSVARVRRA      1 - 70
RTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAK     71 - 140
EDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQNFDAEAVCRSIRATNPSEHTVI    141 - 210
LAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHE    211 - 280
AIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRK    281 - 350
SGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV    351 - 420
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSP    421 - 490
QLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFN    491 - 560
IFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFF    561 - 630
LGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDT    631 - 700
KCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQI    701 - 770
LIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF    771 - 840
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS                             841 - 885
//

Text Mined References (36)

PMID Year Title
25822812 2015 Genetic association study of phosphodiesterase 8B gene with subclinical hypothyroidism in pregnant women.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24497218 2014 Frequency and effect on serum TSH of phosphodiesterase 8B (PDE8B) gene polymorphisms in patients with sporadic nonautoimmune subclinical hypothyroidism.
23941514 2014 The phosphodiesterase 8B gene rs4704397 is associated with thyroid function, risk of myocardial infarction, and body height: the Tromsø study.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23272636 2013 Associations of rs4704397 in phosphodiesterase 8B with thyrotropin and thyroid hormone concentrations.
23237535 2012 Phosphodiesterase 8B gene polymorphism in women with recurrent miscarriage: a retrospective case control study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22781450 2012 [Association analysis of PDE8B gene polymorphisms with the susceptibility to Hyperthyroxinemia in Chinese Han population].
22494929 2012 Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
More...