Property Summary

Ligand Count 118
NCBI Gene PubMed Count 33
PubMed Score 125.64
PubTator Score 46.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hypothyroidism 122 3.182 1.6
Disease Target Count Z-score Confidence
Cushing's syndrome 48 3.671 1.8
Disease Target Count Z-score Confidence
Dystonia 164 4.211 2.1
Carney complex 25 4.011 2.0

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 2.098 1.5e-03
astrocytic glioma 1.700 2.2e-02
Astrocytoma, Pilocytic 1.100 1.7e-02
atypical teratoid / rhabdoid tumor -1.700 2.0e-04
Breast cancer -1.500 2.3e-05
breast carcinoma -1.600 3.7e-03
chronic rhinosinusitis -2.001 6.9e-03
cystic fibrosis and chronic rhinosinusit... -1.738 3.0e-02
ductal carcinoma in situ -2.000 1.5e-03
ependymoma -1.700 2.2e-02
glioblastoma -1.100 2.9e-03
group 3 medulloblastoma -2.200 6.4e-03
intraductal papillary-mucinous carcinoma... -1.200 1.2e-02
lung adenocarcinoma -1.300 1.1e-10
lung carcinoma 2.100 1.3e-16
medulloblastoma, large-cell -2.700 1.1e-04
non-small cell lung cancer -1.001 1.2e-13
oligodendroglioma 1.300 1.6e-02
osteosarcoma -1.400 9.0e-03
ovarian cancer -2.800 1.6e-15
pituitary cancer 1.300 8.8e-03
primitive neuroectodermal tumor -1.600 2.0e-03

Gene RIF (22)

AA Sequence

MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSVARVRRA      1 - 70
RTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAK     71 - 140
EDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQNFDAEAVCRSIRATNPSEHTVI    141 - 210
LAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHE    211 - 280
AIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRK    281 - 350
SGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV    351 - 420
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSP    421 - 490
QLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFN    491 - 560
IFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFF    561 - 630
LGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDT    631 - 700
KCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQI    701 - 770
LIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF    771 - 840
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS                             841 - 885
//

Text Mined References (37)

PMID Year Title