Property Summary

NCBI Gene PubMed Count 14
Grant Count 37
R01 Count 34
Funding $5,144,863.69
PubMed Score 71.06
PubTator Score 35.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
acute quadriplegic myopathy 1.291 0.000
diabetes mellitus -1.100 0.001

Gene RIF (3)

PMID Text
25381249 Data indicate that arginyltransferase 1 (ATE1) function controls Myocardin-related transcription factor A (MRTF-A) activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT      1 - 70
CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL     71 - 140
KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE    141 - 210
IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPP    211 - 280
SSQFKATLLESYQVYKRYQMVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI    281 - 350
IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG    351 - 420
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK    421 - 490
DPSEEAAVLQYASLVGQKCSERMLLFRN                                              491 - 518
//

Text Mined References (18)

PMID Year Title
25381249 2014 Inhibition of arginyltransferase 1 induces transcriptional activity of myocardin-related transcription factor A (MRTF-A) and promotes directional migration.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22665520 2012 Arginylation-dependent regulation of a proteolytic product of talin is essential for cell-cell adhesion.
22280815 2012 Small molecule inhibitors of arginyltransferase regulate arginylation-dependent protein degradation, cell motility, and angiogenesis.
22262859 2012 The C-terminal proteolytic fragment of the breast cancer susceptibility type 1 protein (BRCA1) is degraded by the N-end rule pathway.
21269460 2011 Initial characterization of the human central proteome.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
More...