Property Summary

NCBI Gene PubMed Count 74
Grant Count 104
R01 Count 56
Funding $23,751,389.55
PubMed Score 674.97
PubTator Score 221.85

Knowledge Summary

Patent (19,282)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

Synonym

Accession O95259 B1AQ26 O76035 Q14CL3
Symbols EAG
EAG1
ZLS1
TMBTS
h-eag
hEAG1
Kv10.1

Gene

PDB

5J7E  

Gene RIF (58)

PMID Text
26823849 The expression of Eag1 may be partially explained the aggressive behavior of triple negative breast cancer in the breast cancer tissue.
26783521 Our data indicated that Eag1 promotes osteosarcoma proliferation and migration, at least in part, by targeting STAT3-VEGF pathway.
26518875 Alternatively Spliced Isoforms of KV10.1 Potassium Channels Modulate Channel Properties and Can Activate Cyclin-dependent Kinase
25915598 KCNH1 mutations cause Zimmermann-Laband syndrome.
25783527 Astemizole might have clinical utility for HCC prevention and treatment, and Eag1 channels may be potential early Hepatocellular carcinoma biomarkers
25495694 Repression by calcitriol occurs at the transcriptional level and involves a functional negative vitamin D response element (nVDRE) E-box type in the hEAG1 promoter.
25420144 De novo KCNH1 mutations in exons 6 and 8 in Temple-Baraitser syndrome showed a decreased threshold of activation and delayed deactivation, leading to deleterious gain of function.
25136578 These results suggest that Eag1 plays an important role in regulating the proliferation and cell cycle of liposarcoma cells
24694542 the Eag1 channel plays a crucial role in regulating the proliferation and cell cycle of osteosarcoma cells, and represents a new and effective therapeutic target for osteosarcoma.
24587194 hERG and hEAG channels are regulated by Src and by SHP-1 tyrosine phosphatase via an ITIM region in the cyclic nucleotide binding domain.
More...

AA Sequence

MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFM      1 - 70
YGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPI     71 - 140
EDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHII    141 - 210
LHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEV    211 - 280
ISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLF    281 - 350
SSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY    351 - 420
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLL    421 - 490
YATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICP    491 - 560
KDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQ    561 - 630
DDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYN    631 - 700
LRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGN    701 - 770
VLTEHASANHSLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF    771 - 840
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSPQDRSPILAEV    841 - 910
KHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPE    911 - 980
SERDIFGAS                                                                 981 - 989
//

Text Mined References (76)

PMID Year Title
27325704 2016 Calmodulin Regulates Human Ether à Go-Go 1 (hEAG1) Potassium Channels through Interactions of the Eag Domain with the Cyclic Nucleotide Binding Homology Domain.
27005320 2016 Human EAG channels are directly modulated by PIP2 as revealed by electrophysiological and optical interference investigations.
26823849 2015 Expression of eag1 channel associated with the aggressive clinicopathological features and subtype of breast cancer.
26783521 2015 Silencing of Eag1 Gene Inhibits Osteosarcoma Proliferation and Migration by Targeting STAT3-VEGF Pathway.
26518875 2015 Alternatively Spliced Isoforms of KV10.1 Potassium Channels Modulate Channel Properties and Can Activate Cyclin-dependent Kinase in Xenopus Oocytes.
26503718 2015 Bimodal regulation of an Elk subfamily K+ channel by phosphatidylinositol 4,5-bisphosphate.
25915598 2015 Mutations in KCNH1 and ATP6V1B2 cause Zimmermann-Laband syndrome.
25783527 2015 Astemizole-based anticancer therapy for hepatocellular carcinoma (HCC), and Eag1 channels as potential early-stage markers of HCC.
25495694 2015 A cis-acting element in the promoter of human ether à go-go 1 potassium channel gene mediates repression by calcitriol in human cervical cancer cells.
25420144 2015 Mutations in the voltage-gated potassium channel gene KCNH1 cause Temple-Baraitser syndrome and epilepsy.
More...