Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
R01 Count 10
Funding $1,304,493.01
PubMed Score 27.99
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 0.017
psoriasis -1.300 0.001
osteosarcoma -1.774 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.200 0.000
subependymal giant cell astrocytoma -1.310 0.040
ovarian cancer 1.300 0.002

Gene RIF (10)

PMID Text
23266757 Increased expression of cerebral UCP5 and UCP4 is observed in a model of high altitude hypoxia and mitochondrial oxidative phosphorylation deficiency.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22524567 Neuronal UCP5 exhibits transmembrane chloride transport activity.
22087257 observed significant associations between genetic variants in the SIRT6 and UCP5 genes and atherosclerotic plaque
19910678 The enhanced level of UCP5 is associated to mitochondrial dysfunction in colonic cells.
18018477 The brain may respond to neuroprotection through the increased expression of UCP5 under ischemic conditions.
17066476 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17066476 These findings suggest that UCP2 and UCP4 have a modest but important involvement in the genetic etiology of schizophrenia.
16941493 UCP5 might be physiologically important in the pathology of oxidative stress-induced neurodegeneration
12051969 expressed in skeletal muscle as three different isoforms; expression level of UCP5SI positively correlated with resting metabolic rate and lipid oxidation rate during a euglycemic clamp with infusion of insulin at a physiologic concentration

AA Sequence

MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQV      1 - 70
QGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDET     71 - 140
LLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIV    141 - 210
VGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTV    211 - 280
DGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI                             281 - 325
//

Text Mined References (20)

PMID Year Title
23266757 2013 Evidence for involvement of uncoupling proteins in cerebral mitochondrial oxidative phosphorylation deficiency of rats exposed to 5,000 m high altitude.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23116158 2012 Brain region-specific altered expression and association of mitochondria-related genes in autism.
22950050 2012 Human neuronal uncoupling proteins 4 and 5 (UCP4 and UCP5): structural properties, regulation, and physiological role in protection against oxidative stress and mitochondrial dysfunction.
22524567 2012 Toward understanding the mechanism of ion transport activity of neuronal uncoupling proteins UCP2, UCP4, and UCP5.
22087257 2011 Association of the sirtuin and mitochondrial uncoupling protein genes with carotid plaque.
19910678 2009 Hydrogen peroxide regulates the mitochondrial content of uncoupling protein 5 in colon cancer cells.
18018477 2007 Amplified expression of uncoupling proteins in human brain ischemic lesions.
17066476 2007 Synergistic association of mitochondrial uncoupling protein (UCP) genes with schizophrenia.
16941493 2006 Knockdown of uncoupling protein-5 in neuronal SH-SY5Y cells: Effects on MPP+-induced mitochondrial membrane depolarization, ATP deficiency, and oxidative cytotoxicity.
More...