Property Summary

NCBI Gene PubMed Count 20
PubMed Score 28.98
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 3.6e-04
astrocytic glioma -1.200 1.7e-02
atypical teratoid / rhabdoid tumor -1.300 4.2e-07
glioblastoma -1.400 9.7e-06
medulloblastoma -1.100 1.0e-03
medulloblastoma, large-cell -1.200 4.9e-05
osteosarcoma -1.774 4.3e-06
ovarian cancer 1.300 1.5e-03
psoriasis -1.300 1.2e-03
subependymal giant cell astrocytoma -1.310 4.0e-02

Gene RIF (10)

AA Sequence

MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQV      1 - 70
QGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDET     71 - 140
LLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIV    141 - 210
VGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTV    211 - 280
DGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI                             281 - 325
//

Text Mined References (20)

PMID Year Title