Property Summary

NCBI Gene PubMed Count 48
Grant Count 55
R01 Count 37
Funding $3,550,743.27
PubMed Score 280.71
PubTator Score 39.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.16 1.6

Expression

Gene RIF (28)

PMID Text
26521045 GADD45G protein, human
26378039 Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development.
26172295 we demonstrated that GADD45gamma expression in hepatocellular carcinoma cells was associated with sorafenib sensitivity
25415264 demonstrate for the first time that miR-383 can specifically regulates the expression of Gadd45g by directly targeting to the 3-UTR region of Gadd45g mRNA, a regulatory process conserved in human tumor cells and mouse embryonic stem cells
25126861 Expression of GADD45gamma was significantly higher in pituitary adenomas of female patients.
24577085 Suggest that cucurbitacin E induced mitosis delay is regulated by GADD45gamma overexpression in malignant gliomas.
24104471 The gadd45g gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review)
23897841 GADD45G functions as a negative regulator of the Jak-Stat3 pathway and inhibits hepatocellular carcinoma by inducing cellular senescence.
23793925 Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression in esophageal squamous cell carcinoma.
23616123 Methylation-mediated repression of GADD45G expression is associated with gastric cardia adenocarcinoma.
More...

AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG      1 - 70
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL     71 - 140
FCEESRSVNDWVPSITLPE                                                       141 - 159
//

Text Mined References (49)

PMID Year Title
26521045 2016 Nuclear spheres modulate the expression of BEST1 and GADD45G.
26378039 2015 SIP1 is a downstream effector of GADD45G in senescence induction and growth inhibition of liver tumor cells.
26172295 2015 Growth arrest DNA damage-inducible gene 45 gamma expression as a prognostic and predictive biomarker in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25415264 2014 MicroRNA-383 regulates the apoptosis of tumor cells through targeting Gadd45g.
25126861 2014 Expression analysis of GADD45?, MEG3, and p8 in pituitary adenomas.
24577085 2014 Inducement of mitosis delay by cucurbitacin E, a novel tetracyclic triterpene from climbing stem of Cucumis melo L., through GADD45? in human brain malignant glioma (GBM) 8401 cells.
24104471 2013 Gadd45 in modulation of solid tumors and leukemia.
23897841 2014 Growth arrest and DNA damage 45G down-regulation contributes to Janus kinase/signal transducer and activator of transcription 3 activation and cellular senescence evasion in hepatocellular carcinoma.
23793925 2013 Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression and poor prognosis in esophageal squamous cell carcinoma.
More...