Property Summary

NCBI Gene PubMed Count 53
PubMed Score 286.80
PubTator Score 39.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession O95257 Q5VZ87 Q9C076
Symbols CR6
DDIT2
GRP17
GADD45gamma

Gene

PDB

2WAL   3FFM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG      1 - 70
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL     71 - 140
FCEESRSVNDWVPSITLPE                                                       141 - 159
//

Text Mined References (54)

PMID Year Title