Property Summary

NCBI Gene PubMed Count 42
PubMed Score 27.04
PubTator Score 35.61

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 1.49059747507956E-36
lung carcinoma 2844 4.94625633515264E-20
non-small cell lung cancer 2798 8.31848539122804E-18
lung adenocarcinoma 2714 3.60591639805961E-10
osteosarcoma 7933 2.64822199610889E-5
cutaneous lupus erythematosus 1056 2.67423363476969E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00601570435207001
lung cancer 4473 0.00841471002062734
interstitial cystitis 2299 0.0110170751159785
Common variable immunodeficiency 98 0.0118895199969323
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0175065561711267
mucosa-associated lymphoid tissue lymphoma 480 0.0240408409095265
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Intellectual disability 573 3.087 1.5



Accession O95256 B2RPJ3 Q3KPE7 Q3KPE8 Q53TT4 Q53TU5 IL-18 receptor accessory protein
Symbols ACPL




  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (33)

26289103 This meta-analysis provides robust estimates that IL18RAP rs917997 and chemokine (C-C motif) receptor 3 rs6441961 are potential risk factors for celiac disease in European populations.
24842757 results demonstrate clear functional consequences of the rs917997 risk polymorphism; this polymorphism leads to a loss-of-function through decreased IL-18RAP, IL-18R1, and IL-1R1 protein expression, which impairs autocrine IL-18 and IL-1 signaling
23891168 The SNP modified IL18RAP surface protein expression by NK cells.
22685567 Data indicate that MyD88 works together with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner.
22289858 Data suggest that IL-18RAP and IL-18R1 single-nucleotide polymorphisms identify African-American infants at risk for bronchopulmonary dysplasia.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20647273 Observational study of gene-disease association. (HuGE Navigator)
20353565 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20176734 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

VKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW                                   561 - 599

Text Mined References (42)

PMID Year Title
26289103 2015 Systematic review and meta-analysis of the association between IL18RAP rs917997 and CCR3 rs6441961 polymorphisms with celiac disease risks.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
24842757 2014 The IL18RAP region disease polymorphism decreases IL-18RAP/IL-18R1/IL-1R1 expression and signaling through innate receptor-initiated pathways.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23891168 2013 The autoimmune disease-associated SNP rs917997 of IL18RAP controls IFN? production by PBMC.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22685567 2012 TRAM is involved in IL-18 signaling and functions as a sorting adaptor for MyD88.
22289858 2012 IL-18R1 and IL-18RAP SNPs may be associated with bronchopulmonary dysplasia in African-American infants.