Property Summary

NCBI Gene PubMed Count 44
PubMed Score 27.63
PubTator Score 35.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ulcerative colitis 1.300 6.1e-03
Common variable immunodeficiency -1.037 1.2e-02
cutaneous lupus erythematosus 2.400 2.7e-04
interstitial cystitis 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... -1.200 6.0e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
lung adenocarcinoma -1.300 3.1e-08
lung cancer -2.400 8.4e-03
lung carcinoma -2.400 4.9e-20
mucosa-associated lymphoid tissue lympho... 2.383 2.4e-02
non-small cell lung cancer -1.588 8.3e-18
osteosarcoma -4.188 2.6e-05
psoriasis 1.600 3.7e-03

Protein-protein Interaction (2)

Gene RIF (35)

AA Sequence

MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEH      1 - 70
LPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACC     71 - 140
VKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDE    141 - 210
VYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFE    211 - 280
RVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSV    281 - 350
QLKEKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF    351 - 420
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGPS    421 - 490
IFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMP    491 - 560
VKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW                                   561 - 599
//

Text Mined References (44)

PMID Year Title