Property Summary

NCBI Gene PubMed Count 19
Grant Count 14
R01 Count 8
Funding $457,980.43
PubMed Score 19.85
PubTator Score 160.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma 1.077 0.001
astrocytoma 1.100 0.004
tuberculosis -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.247 0.029
group 4 medulloblastoma 1.100 0.001
ovarian cancer 2.300 0.000
dermatomyositis 1.500 0.000

Gene RIF (6)

PMID Text
23387339 Golgi vesicles, presumably with COPI, serve to inhibit intra-Golgi transport by the extraction of GS27 and GS28 from the Golgi cisternae, which blocks the formation of inter-cisternal connections
22397410 GS28 may potentiate cells to DNA-damage-induced apoptosis by inhibiting the ubiquitination and degradation of p53.
21669198 ORP7 negatively regulates GS28 protein stability via sequestration of GATE-16, and may mediate the effect of 25-OH on GS28 and Golgi function.
20700730 Apolipoprotein E, growth factor receptor-bound protein 2, Golgi SNAP receptor complex member 1, and glucosidase, beta, acid may play a neurodegenerative role in stress urinary incontinence development.
16571679 RINT-1 coordinates the localization and function of ZW10 by serving as a link between ZW10 and the SNARE complex comprising syntaxin 18.
12388752 Data suggest that GS15 exists in a distinct SNARE complex that contains syntaxin5, GS28, and Ykt6, and may be involved in both ER-to-Golgi and intra-Golgi transport.

AA Sequence

MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM      1 - 70
AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG     71 - 140
SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN    141 - 210
RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH                                  211 - 250
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23387339 2013 Segregation of the Qb-SNAREs GS27 and GS28 into Golgi vesicles regulates intra-Golgi transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22397410 2012 Golgi-SNARE GS28 potentiates cisplatin-induced apoptosis by forming GS28-MDM2-p53 complexes and by preventing the ubiquitination and degradation of p53.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21860593 2011 GS28 Protects Neuronal Cell Death Induced by Hydrogen Peroxide under Glutathione-Depleted Condition.
21669198 2011 OSBP-related protein 7 interacts with GATE-16 and negatively regulates GS28 protein stability.
21269460 2011 Initial characterization of the human central proteome.
20700730 2010 Microarray analysis of differentially expressed genes in vaginal tissues in postmenopausal women. The role of stress urinary incontinence.
19946888 2010 Defining the membrane proteome of NK cells.
More...