Property Summary

NCBI Gene PubMed Count 20
PubMed Score 21.66
PubTator Score 160.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 4.4e-03
dermatomyositis 1.500 1.3e-04
group 4 medulloblastoma 1.100 1.0e-03
osteosarcoma 1.077 1.2e-03
ovarian cancer -1.700 1.8e-07
pancreatic ductal adenocarcinoma liver m... 1.247 2.9e-02
psoriasis 1.800 8.9e-05
tuberculosis -1.200 1.8e-05

Gene RIF (7)

AA Sequence

MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM      1 - 70
AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG     71 - 140
SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN    141 - 210
RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH                                  211 - 250
//

Text Mined References (30)

PMID Year Title