Property Summary

NCBI Gene PubMed Count 38
Grant Count 30
R01 Count 10
Funding $2,271,235.67
PubMed Score 69.49
PubTator Score 38.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
25998931 Hepatitis B virus activates the KIF4A gene promoter and upregulates the mRNA and protein expression of KIF4A.
25512391 KIF4A and PP2A-B56G and -B56E create a spatially restricted negative feedback loop counteracting Aurora B in anaphase.
24812067 Genetic association of KIF4A and KIF5C mutations in intellectual disability and synaptic function.
24386490 KIF4A might be a key regulator for tumoral progression in OSCCs.
24237699 Deletion of residues 32-51 in the N-terminus of HIV-1 MA impairs both HIV-1 Gag interaction with KIF4 and its ability to induce microtubule (MT) acetylation, suggesting that MA-mediated targeting of KIF4 by Gag regulates MT stability in early infection
24237699 Deletion of residues 32-51 in the N-terminus of HIV-1 MA impairs both HIV-1 Gag interaction with KIF4 and its ability to induce microtubule (MT) acetylation, suggesting that MA-mediated targeting of KIF4 by Gag regulates MT stability in early infection
23940115 The KIF4A phosphorylation by Aurora B stimulates the maximal microtubule-dependent ATPase activity of KIF4A and promotes its interaction with PRC1.
23870126 Studies reveal how interactions between the conserved nonmotor MAP, PRC1, and the motor protein, kinesin-4, generate filament length-dependent tags at microtubule plus ends. PRC1 tags ends of microtubules in dividing cells and the size of these tags increases linearly with filament length.
23305486 Deletion of residues 32-51 in the N-terminus of HIV-1 MA impairs both HIV-1 Gag interaction with KIF4 and its ability to induce microtubule (MT) acetylation, suggesting that MA-mediated targeting of KIF4 by Gag regulates MT stability in early infection
21994733 Deletion of residues 32-51 in the N-terminus of HIV-1 MA impairs both HIV-1 Gag interaction with KIF4 and its ability to induce microtubule (MT) acetylation, suggesting that MA-mediated targeting of KIF4 by Gag regulates MT stability in early infection
More...

AA Sequence

MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVA      1 - 70
PLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSY     71 - 140
LEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSS    141 - 210
RSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDD    211 - 280
KKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAE    281 - 350
LNHLKQQVQQLQVLLLQAHGGTLPGSITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERI    351 - 420
ILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACMAAAIDT    421 - 490
AVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDN    491 - 560
IKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLNEQSKLLKLKESTE    561 - 630
RTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVL    631 - 700
RRKTEEAAAANKRLKDALQKQREVADKRKETQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLED    701 - 770
RKILAQDVAQLKEKKESGENPPPKLRRRTFSLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQK    771 - 840
LLDAESEDRPKQRWENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFA    841 - 910
EIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQN    911 - 980
QQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEH    981 - 1050
SVNEHEDGDGDDDEGDDEEWKPTKLVKVSRKNIQGCSCKGWCGNKQCGCRKQKSDCGVDCCCDPTKCRNR   1051 - 1120
QQGKDSLGTVERTQDSEGSFKLEDPTEVTPGLSFFNPVCATPNSKILKEMCDVEQVLSKKTPPAPSPFDL   1121 - 1190
PELKHVATEYQENKAPGKKKKRALASNTSFFSGCSPIEEEAH                               1191 - 1232
//

Text Mined References (44)

PMID Year Title
25998931 2015 Hepatitis B virus upregulates the expression of kinesin family member 4A.
25512391 2014 KIF4A and PP2A-B56 form a spatially restricted feedback loop opposing Aurora B at the anaphase central spindle.
24812067 2014 Involvement of the kinesin family members KIF4A and KIF5C in intellectual disability and synaptic function.
24386490 2013 Kinesin family member 4A: a potential predictor for progression of human oral cancer.
23940115 2013 Aurora B suppresses microtubule dynamics and limits central spindle size by locally activating KIF4A.
23870126 2013 Marking and measuring single microtubules by PRC1 and kinesin-4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21566458 2011 Alzheimer A? disrupts the mitotic spindle and directly inhibits mitotic microtubule motors.
21565503 2011 KIF4 regulates midzone length during cytokinesis.
21269460 2011 Initial characterization of the human central proteome.
More...