Property Summary

NCBI Gene PubMed Count 46
PubMed Score 26.37
PubTator Score 77.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 357 9.6e-03
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.2

Expression

  Differential Expression (1)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 2.200 9.6e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRV      1 - 70
AHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEE     71 - 140
VARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDKFCETVKIIIRDQRSVLASAVLGLASIVCTG    141 - 210
LVSYTTLPAIFIPFFLWMAG                                                      211 - 230
//

Text Mined References (44)

PMID Year Title