Property Summary

NCBI Gene PubMed Count 45
Grant Count 86
R01 Count 76
Funding $10,354,830.63
PubMed Score 25.61
PubTator Score 77.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 2.200 0.010

Synonym

Accession O95237 A8K983 Q8N716
Symbols LCA14

Gene

 GWAS Trait (1)

Gene RIF (26)

PMID Text
25383759 These findings reveal structural adaptation that facilitates selective catalysis and mechanism responsible for diverse substrate specificity within the LRAT-like enzyme family
25260806 LRAT hypermethylation was associated with decreased mRNA levels in colorectal cancer clinical specimens.
25236354 lecithin retinol acyltransferase affects all-trans retinoic acid levels and has a role in retinoid sensitivity in malignant melanoma cells.
24613493 Lecithin-retinol acyltransferase is a thermostable and highly active enzyme with a likely mode of interfacial activation.
24433184 high LRAT expression in melanoma might be important in removing retinol as substrate for RA production, thereby inducing signalling pathways leading to dedifferentiation, proliferation and anti-apoptosis
23890161 Functional hepatic stellate cells coexpressing both LRAT and CRBP-1, that continue to maintain the ability to store vitamin A, contribute in part to the development of portal and parenchymal fibrogenesis in patients with viral hepatitis.
22605381 Data show that acyl-modified forms of HRAS-like tumor suppressors HRASLS2 and HRASLS3 mimicking lipolytic activity of lecithin retinol acyltransferase LRAT.
22570351 LRAT mutations cause a severe, early childhood onset, progressive retinal dystrophy.
22559933 A genetic defect was identified in LRAT as a novel cause of retinitis punctata albescens.
21465477 This study showed that malignant melanoma cells are able to esterify all-trans retinol and subsequently isomerize all-trans retinyl esters (RE) into 11-cis retinol, whereas their benign counterparts-melanocytes are not able to catalyze these reactions.
More...

AA Sequence

MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRV      1 - 70
AHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEE     71 - 140
VARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDKFCETVKIIIRDQRSVLASAVLGLASIVCTG    141 - 210
LVSYTTLPAIFIPFFLWMAG                                                      211 - 230
//

Text Mined References (43)

PMID Year Title
25383759 2015 LRAT-specific domain facilitates vitamin A metabolism by domain swapping in HRASLS3.
25260806 2014 High incidence of LRAT promoter hypermethylation in colorectal cancer correlates with tumor stage.
25236354 2014 Knockdown of lecithin retinol acyltransferase increases all-trans retinoic acid levels and restores retinoid sensitivity in malignant melanoma cells.
24613493 2014 Enzymatic activity of Lecithin:retinol acyltransferase: a thermostable and highly active enzyme with a likely mode of interfacial activation.
24433184 2013 Lecithin retinol acyltransferase as a potential prognostic marker for malignant melanoma.
24036882 2014 The retinol esterifying enzyme LRAT supports cell signaling by retinol-binding protein and its receptor STRA6.
23890161 2014 Hepatic stellate cells that coexpress LRAT and CRBP-1 partially contribute to portal fibrogenesis in patients with human viral hepatitis.
22605381 2012 Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.
22570351 2012 Early onset retinal dystrophy due to mutations in LRAT: molecular analysis and detailed phenotypic study.
22559933 2012 A homozygous frameshift mutation in LRAT causes retinitis punctata albescens.
More...