Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.96
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.557 6.4e-03
Breast cancer -3.700 2.9e-02
cutaneous lupus erythematosus 1.300 2.4e-03
fibroadenoma -1.100 4.0e-02
interstitial cystitis 1.300 1.1e-03
lung adenocarcinoma -1.100 3.6e-14
lung cancer -3.500 1.1e-04
lung carcinoma -1.600 1.5e-13
non-small cell lung cancer -1.489 8.3e-17
osteosarcoma -2.180 1.1e-03
ulcerative colitis 1.100 4.3e-03

Gene RIF (6)

AA Sequence

MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFK      1 - 70
RSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEY     71 - 140
VQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAP    141 - 210
FTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSL    211 - 280
LNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLA    281 - 350
LDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH                      351 - 402
//

Text Mined References (19)

PMID Year Title