Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.57
PubTator Score 6.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 8.26181169529488E-17
lung carcinoma 2844 1.46796947327671E-13
lung adenocarcinoma 2714 1.0897974725193E-10
lung cancer 4473 2.03456579124549E-5
osteosarcoma 7933 0.00106108417632786
interstitial cystitis 2299 0.00109854010449399
cutaneous lupus erythematosus 1056 0.00240725947037378
ulcerative colitis 2087 0.00431185988477386
active Crohn's disease 918 0.00643722718072809
Breast cancer 3099 0.029405345039064
fibroadenoma 557 0.0398817871000772

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.002
osteosarcoma -2.180 0.001
non-small cell lung cancer -1.489 0.000
lung cancer -3.800 0.000
active Crohn's disease 1.557 0.006
fibroadenoma -1.100 0.040
Breast cancer -3.700 0.029
interstitial cystitis 1.300 0.001
lung adenocarcinoma -1.557 0.000
lung carcinoma -1.600 0.000
ulcerative colitis 1.100 0.004

Synonym

Accession O95236 B1AHI4 B1AHI5 Q5U5N4 Q9BQ82 Q9BQA3
Symbols CG121
CG12_1
APOLIII
apoL-III

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (6)

PMID Text
20631155 An association between an single nucleotide polymorphisms within the APOL3 locus and prostate cancer risk, is revealed.
20631155 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
11944986 APOL3 has been found only in humans and African green monkeys

AA Sequence

MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFK      1 - 70
RSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEY     71 - 140
VQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAP    141 - 210
FTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSL    211 - 280
LNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLA    281 - 350
LDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH                      351 - 402
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20631155 2010 Family-based association analysis of 42 hereditary prostate cancer families identifies the Apolipoprotein L3 region on chromosome 22q12 as a risk locus.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...