Property Summary

NCBI Gene PubMed Count 24
PubMed Score 34.35
PubTator Score 193.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQY      1 - 70
EKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLL     71 - 140
QQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDD    141 - 210
HLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERERKRRREEEERE    211 - 280
KERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRERRRSRSRDRRRSRSHDRSERKHRSRSRDR    281 - 350
RRSKSRDRKSYKHRSKSRDREQDRKSKEKEKRGSDDKKSSVKSGSREKQSEDTNTESKESDTKNEVNGTS    351 - 420
EDIKSEGDTQSN                                                              421 - 432
//

Text Mined References (40)

PMID Year Title