Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.95
PubTator Score 10.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSS      1 - 70
NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ     71 - 140
NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ    141 - 210
EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF                          211 - 258
//

Text Mined References (17)

PMID Year Title