Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $140,000
PubMed Score 8.49
PubTator Score 10.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
24706756 Data suggest that homeobox transcription factor VentX may be a target to modulate Dendritic cells (DCs) functions and manage inflammatory diseases.
22791709 VentX regulates critical cell cycle regulators and Wnt downstream genes previously implicated in HSC/MPP proliferation and expansion.
21670496 Results provide mechanistic insight into the crucial roles of VentX in macrophage differentiation and proinflammatory activation and suggest that dysregulation of VentX may play a role in the pathogenesis of autoimmune diseases.
21325273 Data show that VentX is a direct transcriptional activator of p53-p21 and p16ink4a-Rb tumor suppression pathways.
20833819 these data extend our insights into the function of embryonic mesodermal factors in human postnatal hematopoiesis and indicate a role for VENTX in normal and malignant myelopoiesis.
20028861 a potential role of VentX in the clinical behavior of hematopoietic malignancies.

AA Sequence

MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSS      1 - 70
NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ     71 - 140
NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ    141 - 210
EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF                          211 - 258
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24706756 2014 Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.
22791709 2012 Suppression of homeobox transcription factor VentX promotes expansion of human hematopoietic stem/multipotent progenitor cells.
21670496 2011 The homeobox transcription factor VentX controls human macrophage terminal differentiation and proinflammatory activation.
21325273 2011 VentX trans-activates p53 and p16ink4a to regulate cellular senescence.
20833819 2010 The vent-like homeobox gene VENTX promotes human myeloid differentiation and is highly expressed in acute myeloid leukemia.
20028861 2010 VentX, a novel lymphoid-enhancing factor/T-cell factor-associated transcription repressor, is a putative tumor suppressor.
17963489 2007 Classification and nomenclature of all human homeobox genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...