Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
R01 Count 5
Funding $383,188
PubMed Score 26.69
PubTator Score 16.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95229 A6NNV6 Q0D2I3 Q9BWD0
Symbols SIP30
ZWINT1
KNTC2AP
HZwint-1

Gene

 GO Function (1)

Gene RIF (8)

PMID Text
26486467 Our results provide the first evidence that Zwint-1 is required to correct erroneous kinetochore-microtubule attachment and regulate spindle checkpoint function during meiosis.
22023800 the E3 ubiquitin ligase terf causes protein degradation of ZWINT and negatively regulates cell proliferation
21775627 These studies identify zwint-1 as a novel AurB substrate required for kinetochore assembly and for proper spindle assembly checkpoint silencing at metaphase
21345172 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain
19008095 Observational study of gene-disease association. (HuGE Navigator)
18268100 Stable hZW10 kinetochore residency at prometaphase kinetochores is dependent on its interaction with hZwint-1, and is essential for mitotic checkpoint arrest.
17373700 Observational study of gene-disease association. (HuGE Navigator)
15485811 show that ZW10 interacting protein-1(Zwint-1) is required and is sufficient for kinetochore localization of Zeste White 10 (ZW10) in HeLa cells

AA Sequence

MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQE      1 - 70
DTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQA     71 - 140
KKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQ    141 - 210
TFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP       211 - 277
//

Text Mined References (29)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26486467 2015 Zwint-1 is required for spindle assembly checkpoint function and kinetochore-microtubule attachment during oocyte meiosis.
25416956 2014 A proteome-scale map of the human interactome network.
23478334 2013 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
22023800 2012 Terf/TRIM17 stimulates degradation of kinetochore protein ZWINT and regulates cell proliferation.
21775627 2011 Zwint-1 is a novel Aurora B substrate required for the assembly of a dynein-binding platform on kinetochores.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21345172 2011 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain.
21269460 2011 Initial characterization of the human central proteome.
More...