Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.69
PubTator Score 16.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 1.29990748446423E-42
non-small cell lung cancer 2798 6.51950510246464E-31
psoriasis 6685 2.2293650730697E-12
atypical teratoid/rhabdoid tumor 1095 7.69649274645531E-11
glioblastoma 5572 1.66669296942174E-10
Breast cancer 3099 1.5236511111217E-9
nasopharyngeal carcinoma 1056 2.61728607058215E-7
lung cancer 4473 3.68623996282868E-7
pediatric high grade glioma 2712 2.75724827143965E-6
group 3 medulloblastoma 2254 3.44939164461985E-6
Atopic dermatitis 944 3.59641187200381E-6
adrenocortical carcinoma 1427 5.07436466671207E-6
pancreatic cancer 2300 9.6878811045038E-6
lung adenocarcinoma 2714 1.39842516154929E-5
primitive neuroectodermal tumor 3031 2.80638373800812E-5
medulloblastoma, large-cell 6234 2.17272421513973E-4
ovarian cancer 8492 4.12835021346088E-4
invasive ductal carcinoma 2950 6.16031425125203E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.17605850712883E-4
posterior fossa group A ependymoma 1511 7.02075818867705E-4
ductal carcinoma in situ 1745 0.00101146891820513
tuberculosis 1563 0.0017388476403869
colon cancer 1475 0.00243621040768078
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00363369895455513
Endometriosis 535 0.00665278127062265
cystic fibrosis and chronic rhinosinusitis 213 0.00915930644309413
pituitary cancer 1972 0.0111669773493152
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0156166753754728
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0266627414259452
pancreatic carcinoma 567 0.0453971977745347
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Retinal disease 16 0.0 2.0
Disease Target Count Z-score Confidence
Roberts syndrome 16 3.692 1.8

Expression

Synonym

Accession O95229 A6NNV6 Q0D2I3 Q9BWD0
Symbols SIP30
ZWINT1
KNTC2AP
HZwint-1

Gene

  Ortholog (7)

 GO Function (1)

Gene RIF (8)

PMID Text
26486467 Our results provide the first evidence that Zwint-1 is required to correct erroneous kinetochore-microtubule attachment and regulate spindle checkpoint function during meiosis.
22023800 the E3 ubiquitin ligase terf causes protein degradation of ZWINT and negatively regulates cell proliferation
21775627 These studies identify zwint-1 as a novel AurB substrate required for kinetochore assembly and for proper spindle assembly checkpoint silencing at metaphase
21345172 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain
19008095 Observational study of gene-disease association. (HuGE Navigator)
18268100 Stable hZW10 kinetochore residency at prometaphase kinetochores is dependent on its interaction with hZwint-1, and is essential for mitotic checkpoint arrest.
17373700 Observational study of gene-disease association. (HuGE Navigator)
15485811 show that ZW10 interacting protein-1(Zwint-1) is required and is sufficient for kinetochore localization of Zeste White 10 (ZW10) in HeLa cells

AA Sequence

MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQE      1 - 70
DTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQA     71 - 140
KKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQ    141 - 210
TFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP       211 - 277
//

Text Mined References (29)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26486467 2015 Zwint-1 is required for spindle assembly checkpoint function and kinetochore-microtubule attachment during oocyte meiosis.
25416956 2014 A proteome-scale map of the human interactome network.
23478334 2013 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
22023800 2012 Terf/TRIM17 stimulates degradation of kinetochore protein ZWINT and regulates cell proliferation.
21775627 2011 Zwint-1 is a novel Aurora B substrate required for the assembly of a dynein-binding platform on kinetochores.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21345172 2011 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain.
21269460 2011 Initial characterization of the human central proteome.
More...