Property Summary

NCBI Gene PubMed Count 27
PubMed Score 28.22
PubTator Score 16.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

 GO Function (1)

Protein-protein Interaction (13)

Gene RIF (8)

AA Sequence

MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQE      1 - 70
DTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQA     71 - 140
KKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQ    141 - 210
TFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP       211 - 277
//

Text Mined References (29)

PMID Year Title