Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
Funding $326,193.46
PubMed Score 9.86
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.204 0.005
psoriasis -1.100 0.000
group 3 medulloblastoma 1.600 0.001
ulcerative colitis -1.077 0.015
progressive supranuclear palsy -1.100 0.010
ovarian cancer 1.300 0.002

Gene RIF (7)

PMID Text
24690921 alpha-taxilin interacts with SNX4 and plays a role in the recycling pathway of TfnR.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19529763 clathrin serving as a regulator of SNX4-dependent transport; upon clathrin release, dynein may bind SNX4 and mediate retrograde movement
17994011 by driving membrane tubulation, SNX4 coordinates iterative, geometric-based sorting of the TfnR with the long-range transport of carriers from early endosomes to the ERC
17319803 study indicates that hVps34 and its product PI(3)P are involved in endosome to Golgi transport of ricin, and that SNX2 and SNX4 are likely to be effectors in this pathway
12668730 Sorting nexin 4 and amphiphysin 2 have roles in endocytosis and intracellular trafficking

AA Sequence

MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTG      1 - 70
RNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHK     71 - 140
LSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNAT    141 - 210
FRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAG    211 - 280
HHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTV    281 - 350
RTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE    351 - 420
ALISYAVMQISMCKKGIQVWTNAKECFSKM                                            421 - 450
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24690921 2014 ?-Taxilin interacts with sorting nexin 4 and participates in the recycling pathway of transferrin receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21973056 2012 SNX-BAR-mediated endosome tubulation is co-ordinated with endosome maturation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19529763 2009 SNX4 in complex with clathrin and dynein: implications for endosome movement.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...