Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.11
PubTator Score 8.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.7e-04
group 3 medulloblastoma 4104 7.6e-04
ovarian cancer 8520 1.6e-03
Multiple myeloma 1332 5.2e-03
progressive supranuclear palsy 676 1.0e-02
ulcerative colitis 1819 1.5e-02
Disease Target Count Z-score Confidence
Batten disease 13 3.529 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.600 7.6e-04
Multiple myeloma 1.204 5.2e-03
ovarian cancer 1.300 1.6e-03
progressive supranuclear palsy -1.100 1.0e-02
psoriasis -1.100 4.7e-04
ulcerative colitis -1.077 1.5e-02

Gene RIF (8)

AA Sequence

MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTG      1 - 70
RNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHK     71 - 140
LSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNAT    141 - 210
FRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAG    211 - 280
HHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTV    281 - 350
RTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE    351 - 420
ALISYAVMQISMCKKGIQVWTNAKECFSKM                                            421 - 450
//

Text Mined References (24)

PMID Year Title