Property Summary

NCBI Gene PubMed Count 12
PubMed Score 26.70
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.3e-07
atypical teratoid / rhabdoid tumor 1.600 9.9e-08
glioblastoma 1.400 3.3e-08
group 3 medulloblastoma 1.100 3.9e-03
invasive ductal carcinoma 1.200 1.3e-02
juvenile dermatomyositis 1.078 5.9e-16
lung cancer -1.500 4.5e-04
malignant mesothelioma -2.200 3.1e-07
medulloblastoma, large-cell 1.700 1.4e-05
osteosarcoma -1.355 3.5e-03
ovarian cancer -2.700 2.3e-07
pediatric high grade glioma 1.400 1.6e-08
pituitary cancer 1.400 2.4e-07
posterior fossa group B ependymoma 1.200 1.3e-10
primitive neuroectodermal tumor 1.400 9.5e-05
psoriasis -1.500 1.3e-04
tuberculosis -1.800 1.1e-05

Synonym

Accession O95214 E9PHP8 Q9BW48
Symbols Vps55
my047
HSPC112

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELA      1 - 70
IFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW              71 - 131
//

Text Mined References (13)

PMID Year Title