Property Summary

NCBI Gene PubMed Count 14
Grant Count 9
Funding $1,140,765.93
PubMed Score 7.38
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lafora disease 9 3.449 1.7

Expression

Gene RIF (1)

PMID Text
21893048 Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding.

AA Sequence

MGAVWSALLVGGGLAGALFVWLLRGGPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELV      1 - 70
TKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEV     71 - 140
SRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHS    141 - 210
SWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQF    211 - 280
IAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV    281 - 350
VHAWWGIH                                                                  351 - 358
//

Text Mined References (17)

PMID Year Title
27358407 2016 Starch Binding Domain-containing Protein 1 Plays a Dominant Role in Glycogen Transport to Lysosomes in Liver.
25416956 2014 A proteome-scale map of the human interactome network.
24837458 2014 The carbohydrate-binding domain of overexpressed STBD1 is important for its stability and protein-protein interactions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21893048 2011 Starch-binding domain-containing protein 1 (Stbd1) and glycogen metabolism: Identification of the Atg8 family interacting motif (AIM) in Stbd1 required for interaction with GABARAPL1.
20810658 2010 Starch binding domain-containing protein 1/genethonin 1 is a novel participant in glycogen metabolism.
20562859 2010 Network organization of the human autophagy system.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...