Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.03
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 5.99366527599022E-7
cutaneous lupus erythematosus 1056 0.00146225247507237
oligodendroglioma 2849 0.00851258385205531
subependymal giant cell astrocytoma 2287 0.0461452321450045

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.400 0.009
cutaneous lupus erythematosus -1.300 0.001
pilocytic astrocytoma 1.700 0.000
subependymal giant cell astrocytoma -1.011 0.046

Synonym

Accession O95208 A8MTV8 B3KRX8 E9PBC2 O95207 Q52LD0 Q9H7Z2 Q9UPT7
Symbols EHB21

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA EggNOG

 GWAS Trait (1)

Gene RIF (3)

PMID Text
25871009 Epsins are required for Dishevelled stability and Wnt signalling activation in colon cancer development.
22174317 HIV-1 Rev interacting protein, epsin 2 (EPN2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EPN2 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN      1 - 70
WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL     71 - 140
KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT    141 - 210
GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL    211 - 280
QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK    281 - 350
AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATVQSVPKNSDPWAASQQPASS    351 - 420
AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF    421 - 490
ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ    491 - 560
PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA    561 - 630
QATGTTNPFLL                                                               631 - 641
//

Text Mined References (23)

PMID Year Title
25871009 2015 Epsin is required for Dishevelled stability and Wnt signalling activation in colon cancer development.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18199683 2008 The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...