Property Summary

NCBI Gene PubMed Count 21
PubMed Score 170.88
PubTator Score 67.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.8
Disease Target Count Z-score Confidence
Pyelonephritis 13 3.897 1.9
Acute cystitis 35 3.544 1.8
Atherosclerosis 291 3.415 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.500 1.2e-02
astrocytic glioma -2.300 7.1e-03
Astrocytoma, Pilocytic -3.000 1.3e-04
Down syndrome -1.400 4.6e-02
ependymoma -3.200 2.1e-02
glioblastoma -2.400 1.3e-03
medulloblastoma -1.800 2.9e-02
non primary Sjogren syndrome sicca -1.100 2.4e-02
oligodendroglioma -1.800 5.0e-02
psoriasis -1.300 1.7e-02

 GO Function (1)

Gene RIF (8)

AA Sequence

MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFN      1 - 70
SSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVHVEVEVRDVNDHAPRFPRAQI     71 - 140
PVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSPFRVELQTRADGAQCADLVLLQELDRESQAA    141 - 210
YSLELVAQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGD    211 - 280
VVFAFGARTPPEARRLFRLDPRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDN    281 - 350
APDIAITPLAAPGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD    351 - 420
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTVRPYTVRVGDE    421 - 490
NDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAEVGRAGGAVSTYVSVDPATGA    491 - 560
IYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVLDQNDHAPVLVHPAPANGSLEVAVPGRTAKD    561 - 630
TVVARVQARDADEGANGELAFELQQQEPREAFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPL    631 - 700
TTTATVSFVVTAGGGRGPAAPASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAI    701 - 770
ATTCNRRKKEVRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP    771 - 840
PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHSFNTISGREAE    841 - 910
KFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCSGPNAHPSPHP    911 - 980
PAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVP    981 - 1050
LYQSPPGRYLSPKKGANENV                                                     1051 - 1070
//

Text Mined References (24)

PMID Year Title