Property Summary

NCBI Gene PubMed Count 21
Grant Count 63
R01 Count 25
Funding $10,236,661.23
PubMed Score 240.20
PubTator Score 67.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.300 0.007
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -1.800 0.050
psoriasis -1.300 0.017
glioblastoma -4.000 0.000
medulloblastoma -1.800 0.029
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -3.000 0.000
non primary Sjogren syndrome sicca -1.100 0.024
Down syndrome -1.400 0.046

Synonym

Accession O95206 B4DMV7 Q5TAN1 Q5TAN2 Q8IYE9 Q96SF1
Symbols PAPC
ARCADLIN

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (8)

PMID Text
25927589 PCDH8 methylation may be associated with tumor progression and poor prognosis in non-muscle invasive bladder cancer.
25486497 Promoter methylation of protocadherin8 is a frequent event in prostate cancer, and might be used as an independent prognostic factor for biochemical recurrence-free survival in patients with prostate cancer.
25416427 PCDH8 methylation may be a useful biomarker to predict the progression of clear cell renal cell carcinoma.
22941331 study demonstrates the epigenetic inactivation of PCDH8 by promoter methylation and its tumor suppressor function in gastric cancer
22909775 Loss of the PCDH8 gene is one of the probable causes of psychomotor delay in RB1-deleted patients.
22273848 Frequently inactivation by promoter methylation of Protocadherin8 is associated with nasopharyngeal carcinoma.
18408767 Loss of PCDH8 promotes oncogenesis in epithelial human cancers by disrupting cell-cell communication dedicated to tissue organization and repression of mitogenic signaling.
12884975 These results suggest that any contribution of PCDH8 polymorphisms to schizophrenia susceptibility is likely to be weak, although the existence of rare variations of stronger effect cannot be excluded.

AA Sequence

MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFN      1 - 70
SSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVHVEVEVRDVNDHAPRFPRAQI     71 - 140
PVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSPFRVELQTRADGAQCADLVLLQELDRESQAA    141 - 210
YSLELVAQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGD    211 - 280
VVFAFGARTPPEARRLFRLDPRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDN    281 - 350
APDIAITPLAAPGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD    351 - 420
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTVRPYTVRVGDE    421 - 490
NDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAEVGRAGGAVSTYVSVDPATGA    491 - 560
IYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVLDQNDHAPVLVHPAPANGSLEVAVPGRTAKD    561 - 630
TVVARVQARDADEGANGELAFELQQQEPREAFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPL    631 - 700
TTTATVSFVVTAGGGRGPAAPASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAI    701 - 770
ATTCNRRKKEVRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP    771 - 840
PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHSFNTISGREAE    841 - 910
KFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCSGPNAHPSPHP    911 - 980
PAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVP    981 - 1050
LYQSPPGRYLSPKKGANENV                                                     1051 - 1070
//

Text Mined References (24)

PMID Year Title
25927589 2014 Clinical significance of protocadherin 8 (PCDH8) promoter methylation in non-muscle invasive bladder cancer.
25486497 2014 Promoter methylation of protocadherin8 is an independent prognostic factor for biochemical recurrence of early-stage prostate cancer.
25416427 2014 Aberrant methylation of PCDH8 is a potential prognostic biomarker for patients with clear cell renal cell carcinoma.
22941331 2012 Frequent silencing of protocadherin 8 by promoter methylation, a candidate tumor suppressor for human gastric cancer.
22909775 2013 Fine mapping of whole RB1 gene deletions in retinoblastoma patients confirms PCDH8 as a candidate gene for psychomotor delay.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
22273848 2012 Protocadherin8 is a functional tumor suppressor frequently inactivated by promoter methylation in nasopharyngeal carcinoma.
18408767 2008 PCDH8, the human homolog of PAPC, is a candidate tumor suppressor of breast cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...