Property Summary

NCBI Gene PubMed Count 30
Grant Count 2
R01 Count 2
Funding $128,920.83
PubMed Score 37.80
PubTator Score 38.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -4.100 0.000
osteosarcoma -3.086 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.012

Synonym

Accession O95202 B4DED2 Q9UF65
Symbols

Gene

 Grant Application (2)

Gene RIF (23)

PMID Text
26722481 LETM1 plays an important role in the progression of breast cancer
25617527 LETM1 protein overexpression is associated with Triple negative breast cancer progression, and may be a potential biomarker for poor prognostic evaluation of Triple negative breast cancer.
25077561 Reconstitution of LETM1 or antioxidant overexpression rescued mitochondrial Ca(2+) transport and bioenergetics
24898248 NCLX, but not LETM1, mediates Ca(2+) extrusion from mitochondria. By controlling the duration of matrix Ca(2+) elevations, NCLX contributes to the regulation of NAD(P)H production and to the conversion of Ca(2+) signals into redox changes.
24689060 LETM1 plays an important role in the progression of head and neck squamous cell carcinoma.
24626991 These findings identify novel cellular phenotypes in Wolf-Hirschhorn syndrome attributable to a 50% reduction in LETM1 expression level.
24344246 Functional properties of Letm1 described in study are remarkably similar to those of the H(+)-dependent Ca(2+) transport mechanism identified in intact mitochondria.
23963300 Haploinsufficiency of WHSC1 and/or LETM1 contributes to Wolf-Hirschhorn Syndrome, but that loss of distinct and/or additional genes in 4p16.3 is necessary for the expression of the core Wolf-Hirschhorn Syndrome phenotype.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of leucine zipper-EF-hand containing transmembrane protein 1 (LETM1) expression by HIV-1 Vpr in Vpr transduced macrophages
23716663 Data indicate that loss of Letm1 contributes to the pathology of Wolf-Hirschhorn syndrome and may contribute to seizure phenotypes by reducing glucose oxidation and other specific metabolic alterations.
More...

AA Sequence

MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHL      1 - 70
GCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV     71 - 140
YSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLV    141 - 210
PFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKG    211 - 280
SATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTM    281 - 350
RLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA    351 - 420
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQKRSE    421 - 490
VAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKK    491 - 560
SLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQ    561 - 630
QAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDV    631 - 700
HISTSQVAEIVATLEKEEKVEEKEKAKEKAEKEVAEVKS                                   701 - 739
//

Text Mined References (35)

PMID Year Title
26722481 2015 LETM1 overexpression is correlated with the clinical features and survival outcome of breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25617527 2015 Clinical implication of leucine zipper/EF hand-containing transmembrane-1 overexpression in the prognosis of triple-negative breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25077561 2014 LETM1-dependent mitochondrial Ca2+ flux modulates cellular bioenergetics and proliferation.
24898248 2014 NCLX protein, but not LETM1, mediates mitochondrial Ca2+ extrusion, thereby limiting Ca2+-induced NAD(P)H production and modulating matrix redox state.
24689060 2014 High expression of leucine zipper-EF-hand containing transmembrane protein 1 predicts poor prognosis in head and neck squamous cell carcinoma.
24626991 2014 LETM1 haploinsufficiency causes mitochondrial defects in cells from humans with Wolf-Hirschhorn syndrome: implications for dissecting the underlying pathomechanisms in this condition.
24344246 2014 Functional reconstitution of the mitochondrial Ca2+/H+ antiporter Letm1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...