Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.48
PubTator Score 1.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 2.0e-03
Amyotrophic lateral sclerosis -1.030 2.9e-04
atypical teratoid / rhabdoid tumor -1.100 2.3e-03
glioblastoma -1.300 1.1e-03
group 4 medulloblastoma -1.100 2.8e-02
medulloblastoma, large-cell -1.600 4.0e-05
Multiple Sclerosis 2.100 5.8e-04

Gene RIF (2)

AA Sequence

MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGA      1 - 70
WGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGR     71 - 140
LDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTS    141 - 210
SVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPE    211 - 280
KPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSH    281 - 350
LIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH    351 - 420
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH    421 - 490
LTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT          491 - 554
//

Text Mined References (13)

PMID Year Title